Гдз по биологии тпо: ГДЗ по биологии 6 класс рабочая тетрадь Пономарева Корнилова Кучменко


ГДЗ по биологии 6 класс рабочая тетрадь Пономарева Корнилова Кучменко

ГДЗ готовые домашние задания к рабочей тетради по биология 6 класс рабочая тетрадь Пономарева Корнилова Кучменко 1 и 2 часть ФГОС от Путина. Решебник (ответы на вопросы и задания) учебников и рабочих тетрадей необходим для проверки правильности домашних заданий без скачивания онлайн

Выберите параграф Рабочей тетради

Часть 1

§ 1. Царство Растения. Внешнее строение и общая характеристика растений
§ 2. Многообразие жизненных форм растений
§ 3. Клеточное строение растений. Свойства растительной клетки
§ 4. Ткани растений
Подведём итоги. Что вы узнали из материалов главы 1
§ 5. Семя, его строение и значение
§ 6. Условия прорастания семян
§ 7. Корень, его строение и значение
§ 8. Побег, его строение и развитие
§ 9. Лист, его строение и значение
§ 10. Стебель, его строение и значение
§ 11. Цветок, его строение и значение
§ 12.

Плод. Разнообразие и значение плодов
Подведём итоги. Что вы узнали из материалов главы 2 — органы растений
§ 13. Минеральное питание растений и значение воды
§ 14. Воздушное питание растений — фотосинтез
§ 15. Дыхание и обмен веществ у растений
§ 16. Размножение и оплодотворение у растений
§ 17. Вегетативное размножение растений и его использование человеком
§ 18. Рост и развитие растений
Подведём итоги. Что вы узнали из материалов главы 3 — Основные процессы жизнедеятельности растений

Часть 2

§ 19. Систематика растений, её значение для ботаники
§ 20. Водоросли, их многообразие в природе
§ 21. Отдел Моховидные. Общая характеристика и значение

§ 22. Плауны. Хвощи. Папоротники. Их общая характеристика
§ 23. Отдел Голосеменные. Общая характеристика и значение
§ 24. Отдел Покрытосеменные. Общая характеристика и значение
§ 25. Семейства класса Двудольные
§ 26. Семейства класса Однодольные
§ 27. Историческое развитие растительного мира
§ 28. Разнообразие и происхождение культурных растений
§ 29. Дары Нового и Старого Света
Подведём итоги. Что вы узнали из материала главы 4
§ 30. Понятие о природном сообществе — биогеоценозе и экосистеме
§ 31. Приспособленность растений к совместной жизни в природном сообществе
§ 32. Смена природных сообществ и её причины
Подведём итоги. Что вы узнали из материалов главы 5
Дневник наблюдений за сезонными изменениями в природе (сентябрь-декабрь)
Дневник наблюдений за сезонными изменениями в природе (январь-март)
Дневник наблюдений за сезонными изменениями в природе (апрель-июнь)
Дневник наблюдений за сезонными изменениями в природе (июнь-август)

ГДЗ по Биологии за 8 класс Рабочая тетрадь Колесов Д.В., Маш Р.Д.

Биология 8 класс Колесов Д.В. рабочая тетрадь

Авторы: Колесов Д.

В., Маш Р.Д., Беляев И.Н.

К восьмому классу ученики приобретают уже достаточно солидные знания по биологии. В большинстве школ её освоение начинается с пятого класса. Но теперь у них наступает серьёзная пора – острая нехватка времени для работы со всеми предметами. В прошлом учебном году началось знакомство с физикой, геометрией, алгеброй. А в нынешнем – с химией. Каждая из этих наук настолько сложна, что может полностью завладеть всем вниманием и временем школьника. Но любой предмет не потерпит, чтобы работу с ним выполняли небрежно. Поэтому так важно обеспечить поддержку качественного консультанта, который подскажет ученику, как лучше работать с каждым предметом. В изучении биологии именно таким виртуальным репетитором является –

«ГДЗ по биологии 8 класс Рабочая тетрадь Колесов, Маш (Дрофа)».

Пособие по по биологии 8 класс тетрадь Колесов – виртуальный консультант

Биология – наука чрезвычайно интересная. Она рассказывает ученикам о строении их собственного организма и многочисленных живых существах, нас окружающих. Но нужно распределить время на подготовку ко всем урокам. Впрочем, в программе биологии встречаются такие сложные темы, что без помощника очень сложно в них разобраться, даже если бы эта наука была единственным предметом, с которым занимаются восьмиклассники. А как же изучить её наравне с другими дисциплинами? Оптимальный вариант – с помощью виртуального консультанта, который сможет разъяснить ученику все нюансы —

«ГДЗ по биологии 8 класс Рабочая тетрадь Колесов Д.В., Маш Р.Д., Беляев И.Н. (Дрофа)». Что включено в ГДЗ:

  1. Виды темперамента и особенности нервной системы.
  2. Форма проявления познавательной деятельности.
  3. Покровные органы и терморегуляция.
  4. Строение головного мозга.
  5. Что такое дыхание и каков его механизм.
  6. Лёгочное и клеточное дыхание.

Каждое задание сопровождается чрезвычайно подробным и понятным образцом ответа, таким образом решебник помогает подготовиться не только к текущему уроку, но и к любой контрольной проверке знаний в классе.

Что мы узнаем с помощью решебника

Все параграфы и разделы биологии необходимы не только для успешного обучения в восьмом классе, но и могут оказать практическую пользу, объясняя действия в некоторых экстремальных ситуациях и подсказывая способы оказания первой медицинской помощи:

  • действия при термических, кислотных и щелочных ожогах;
  • как помочь человеку при обморожении;
  • профилактика кожных заболеваний – стригущего лишая и чесотки;
  • что мы знаем о строении головного мозга;
  • функции эндокринной системы человека.

Большинство ответов решебника снабжено схемами и таблицами, которые позволят без лишних затрат времени досконально разобраться в каждой изучаемой теме.

Гдз по биологии тпо. Рабочая тетрадь по биологии

Рабочая тетрадь является составной частью учебно-методического комплекта серии «Линия жизни» для 5-6 классов под редакцией В. В. Пасечника и адресована учащимся, занимающимся по учебнику этой линии.
Структура пособия соответствует тематической структуре учебника «Биология. 5-6 классы» и содержит разнообразные вопросы и задания, направленные на отработку широкого спектра необходимых умений. В пособие также включены задания для контроля, которые помогут лучше подготовиться к проверке знаний.

Пособие предназначено для самостоятельной работы учащихся дома или на уроке.

Тетрадь является приложением к учебнику В. В. Пасечника «Биология. Бактерии, грибы, растения. 5 класс». Учебник соответствует Федеральному государственному образовательному стандарту основного общего образования. Помимо тетради в состав УМК входят электронное приложение, методическое пособие и рабочая программа.
Тетрадь содержит различные репродуктивные и творческие вопросы и задания, в том числе в виде лабораторных работ, познавательных задач, таблиц, схем, рисунков и терминологических кроссвордов. В тетрадь включены также тестовые задания, которые помогут ученикам подготовиться к успешной сдаче ЕГЭ и ГИА.

Специальными знаками отмечены задания, направленные на формирование метапредметных умений (планировать деятельность, выделять различные признаки, сравнивать, классифицировать и др.) и личностных качеств учеников.

Скачать и читать Биология, Бактерии, Грибы, Растения, 5 класс, Рабочая тетрадь, Пасечник В.В., 2015

Предлагаемая тетрадь — часть учебного комплекса к учебнику Н. и. Сонина «Биология. Живой организм. 6 класс». Специальными знаками отмечены задания, направленаые на формирование метапредметных умений (планировать деятельность, выделять различные признаки, сравнивать, классифицировать и др.) и личностных качеств учеников.

Материал в тетради расположен в той же последовательности, что и в учебнике. В конце каждого раздела помещена рубрика «Тренировочные задания», вопросы которой составлены по форме и с учетом требований ЕГЭ. Работа с тетрадью поможет учащимся лучше освоить содержание курса.
Учебник соответствует (Федеральному образовательному стандарту основного общего образования. Помимо тетради в состав УМК входят электронное приложение, методическое пособие и рабочая программа.

Рассмотрите рисунки цветков. Найдите на них цветоножку, цветоложе, чашелистики, лепестки, тычинки, пестики (с завязью, столбиком и рыльцем) и раскрасьте каждую часть цветка одним цветом (например, чашечки — зелёным, венчики — жёлтым и т. д.).

Скачать и читать Биология, живой организм, 6 класс, рабочая тетрадь к учебнику Сонина Н.И. «Биология, Живой организм, 6 класс», Сонин Н.И., 2014

Рабочая тетрадь разработана к учебнику «Основы общей биологии» для учащихся 9 класса (авт. И.Н. Пономарева, О.А. Корнилова, Н.М. Чернова). Предлагаемые в ней задания, имеющие различный познавательно-обучающий характер, соответствуют названным разделам и параграфам учебника. Они позволят учителю организовать дифференцированную практическую работу девятиклассников, а ученикам — приобрести качественные знания по общей биологии.

Скачать и читать Биология, 9 класс, Рабочая тетрадь, Козлова Т. А., Кучменко В.С., 2013

Предлагаемая тетрадь — часть учебного комплекта к учебнику В. Б. Захарова, Н. И. Сонина «Биология. Многообразие живых организмов». В нее включены разнообразные вопросы, задания, лабораторные работы.
Материал в тетради располагается в той же последовательности, что и в учебнике. Работа с тетрадью поможет ученикам лучше усвоить содержание учебника и подготовиться к успешной сдаче ЕГЭ и ГИА при помощи тестовых заданий, включенных в рабочую тетрадь.

Скачать и читать Биология, Многообразие живых организмов, 7 класс, Рабочая тетрадь, Захаров В.Б., Сонин Н.И., 2014

Рабочая тетрадь является дополнением к учебникам В. Б. Захарова, С.Г. Мамонтова, Н. И. Сонина, Е. Т. Захаровой «Биология. Общая биология. Профильный уровень, 10 класс» и «Биология, Общая биология. Профильный уровень. 11 класс».

Рабочая тетрадь позволит лучше усвоить» систематизировать и закрепить знания, полученные при изучении материала учебника.

В конце тетради помещены «Тренировочные задания», составленные по форме и с учетом требований ЕГЭ, которые помогут учащимся лучше усвоить содержание курса.

  • Почему преподаватели рекомендуют использовать решебники? Что такое ГДЗ – онлайн шпаргалка или незаменимый в обучении инструмент? На эти и другие вопросы школьники и их родители легко ответят сами, получив в свое распоряжение практичное издание.
  • Рабочие тетради предлагаются в качестве эффективного подспорья в учебе. Дидактические комплексы-практикумы – ежедневный арсенал педагога, умелый наставник для школьника и справочник для подзабывших школьную программу родителей. Наличие готовых ответов – не что иное, как «путеводная нить» для каждой из категорий.
  • Для подготовки домашних работ в 9 классе рекомендуется использовать пособие, которое составили В.В. Пасечник, Г.Г. Швецов. Авторы приложили все усилия, чтобы каждый нашел в издании нужное и полезное:
    — педагоги – поурочный учебный комплекс;
    — школьник – инструмент для шлифовки знаний;
    — родители – возможность проверить домашние задания.
  • Уроки биологии в 9 классе охватывают объемный учебный материал: от молекулярной теории до эволюционных гипотез. Школьники не только продолжают познавать мир, но и знакомятся с азами исследовательской деятельности.
  • ГДЗ – это возможность закрепить усвоенную на уроках информацию, применить её на практике и проверить полученные результаты. Правильный подход к использованию решебника принесет толк, неправильный – усугубит проблемы. Выбор за вами!
  • Биология — девятиклассникам: эффективные рабочие тетради и решебники

  • Занимаясь по рабочей тетради по биологии для 9 класса, составленной Пасечником В. В. и Швецовым Г. Г. и выпущенной издательством Дрофа, учащиеся получат полное и глубокое, проработанное на практике представление о таких разделах и темах курса, как:
    — роль и место биологии в системе современных наук, методы проводимых биологических исследований;
    — основополагающие понятия и принципы науки о клетке — цитологии, клеточные теории и химический состав основного элемента всех живых организмов на планете, протекающие в клетках процессы — обмен веществ, биосинтез белка и другие;
    — понятие организмов, их индивидуальное развитие и размножение, способы и особенности процессов;
    — генетика, её закономерности и формы, теории и их практическая проверка.
  • Используя специальный решебник к пособию, девятиклассники смогут самостоятельно, в своем темпе и исходя из своих задач и целей, составить эффективный план работы и достичь желаемого. В основе такого планирования работы с ГДЗ должны лежать:
    — оценка базового уровня знаний школьника;
    — результат, который он стремится достигнуть такой работой — участие и победа в олимпиадах по предмету, улучшение текущего и итогового балла по биологии, подготовка к сдаче ОГЭ по этой дисциплине;
    — самоконтроль и самопроверка достижений, выявление и своевременное исправление возникающих недостатков, устранение проблем, корректировка планов.
  • Работать с помощью сборников готовых домашних заданий девятиклассники могут самостоятельно или привлекая в помощь специалистов — репетиторов и руководителей подготовительных курсов и кружков по биологии. Еще одно важное преимущество такой методики — постоянное наблюдение принципа грамотной записи результатов. Часто верно полученный, но неправильно отображенный ответ ведет к снижению балла, а на конкурсах, олимпиадах и аналогичных мероприятиях — к потере призового места, проигрышу. Работа же с готовыми домашними заданиями в регулярном режиме позволит избавиться от подобного риска, главное — быть внимательным не только к решению, но и к написанию результатов.
  • Сборник рекомендован многими экспертами и специалистами, нередко используется выпускниками одиннадцатого класса, готовящимися сдавать ЕГЭ по биологии для повторения непростого и объемного материала курса девятого класса.

Поможет получать пятерки любому школьнику ГДЗ по биологии рабочая тетрадь 9 класс Пасечник В.В. Далеко не каждый ученик осознает, что от качества его школьного обучения зависит вся его дальнейшая жизнь. Большинство детей и подростков относятся к одиннадцати классам как к долгосрочному наказанию. На самом деле, то, как человек показывает себя в данный период сильно влияет на его будущую карьеру. Если обратиться к статистике, то можно заметить весьма любопытные факты. Так, все бюджетные места в престижных университетах страны занимают отличники и, куда реже, хорошисты. Они получают красный диплом, а с ним идут устраиваться на престижные должности в крупные фирмы или государственные учреждения. Многие и вовсе начинают свой, довольно успешный, бизнес. Связано это с тем, что эти люди — одни из самых дисциплинированных, трудолюбивых и ответственных: они никогда не бросают дело на полпути. Кроме того, есть своеобразные бонусы в том, чтобы иметь превосходный аттестат:

  1. Им сходят с рук пропущенные уроки и не написанные проверочные работы. Связано это с тем, что учителя прекрасно знают, что они смогут наверстать весь пропущенный материал.
  2. Они практически не знают что такое волнение на тестах. Холодному разуму, стойкости и умению собираться в критических ситуациях их научил опыт посещения множества олимпиад и конкурсов. Участие в них также может принести неплохие бонусы в вузе: к примеру, повышенную стипендию или гранты.
  3. С ними хотят дружить почти все, т.к. они могут дать списать на контрольной работе. Они пользуются настоящим авторитетом среди своих сверстников.

Как преодолеть трудности с пособием по биологии для рабочей тетради за 9 класс от Пасечника

Чтобы добиться такого положения, необходимо стараться. Так, школьник обязан посещать каждое занятие, выполнять любое упражнения — только так рабочая программа будет усвоена. Важно вовремя устранять пробелы в знаниях. К примеру, часто они возникают с таким предметом как алгебра. Царица наук не терпит забытых правил — все нужно учить наизусть. Однако делать этого не придется — достаточно просто открыть ГДЗ по учебнику Пасечника В.В. ФГОС за 9 класс онлайн. В решебнике по биологии для 9 класса, рабочая тетрадь, авторы: В.В. Пасечник, Г.Г. Швецов есть:

  1. Верные ответы на любой номер.
  2. Подробные решения заданий.
  3. Есть и выполненные контрольные работы.

Тематические материалы:

Обновлено: 08.07.2020


Если заметили ошибку, выделите фрагмент текста и нажмите Ctrl+Enter

▶▷▶▷ биология 5 класс пасечник тпо гдз

▶▷▶▷ биология 5 класс пасечник тпо гдз
Тип лицензияFree
Кол-во просмотров257
Кол-во загрузок132 раз

биология 5 класс пасечник тпо гдз — ГДЗ по биологии 5 класс рабочая тетрадь Пасечник gdz-putinainfo 5 -klassprirodovedenie- 5 gdz Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник ответы ГДЗ готовые домашние задания к рабочей тетради Биология 5 класс Пасечник ФГОС от Путина Гдз по биологии за 5 класс, автор Пасечник 2016 reshebamegdzbiologija 5 -klasspasechnik Cached Подробные ответы, гдз и решебник по биологии для 5 класс , автора ВВ Пасечник , издательство Дрофа 2016 год ГДЗ по биологии 5 класс Пасечник (рабочая тетрадь) gdzlolonlinebiologiya- 5 -klass-pasechnik Cached Биология 5 класс Пасечник Биология 5 класс Плешаков, Введенский Чтобы в следующий раз не искать сайт — добавь его в закладки ГДЗ по биологии 5 класс рабочая тетрадь Пасечник ответы yagdzcom 5 -klassbiologiya- 5 gdz-po-biologii- 5 Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник Рабочая тетрадь Биология Бактерии, грибы, растения 5 класс В В Пасечника с шишкой ГДЗ решебник по биологии 5 класс рабочая тетрадь Пасечник gdzputinaco 5 -klass-onlajnprirodovedenie- 5 gdz Cached ГДЗ решебник по биологии 5 класс рабочая тетрадь Пасечник Суматохин Здесь представлены ответы к рабочей тетради по биология 5 класс Пасечник , Суматохин, Калинова, Швецов, Гапонюк ГДЗ по биологии за 5 класс рабочая тетрадь ВВ Пасечник, СВ onlinegdzapp 5 -klassbiologiyasumatohin-tetrad Cached Лучшие гдз по биологии за 5 класс рабочая тетрадь , ВВ Пасечник , СВ Суматохин, ГС ГДЗ по биологии рабочая тетрадь 5 класс ВВ Пасечник reshebamegdzbiologija 5 -klasssumatohin-tetrad Cached Чтобы без труда усвоить содержимое книги, стоить применить ГДЗ к рабочей тетради по биологии 5 класс , автор: Пасечник ВВ Этот сборник не только облегчит процесс выполнения домашки, но и ГДЗ по биологии 5 класс рабочая тетрадь Пасечник с ракушкой yagdzcom 5 -klassbiologiya- 5 gdz-po-biologii- 5 Cached Все ГДЗ 5 класс Биология ГДЗ по биологии 5 класс рабочая тетрадь Пасечник с ракушкой Ответы к рабочей тетради по биологии 5 класс (Пасечник) pobioru 5 -klassrabochaya-tetrad-po-biologii Cached Главная 5 класс Рабочая тетрадь по биологии для 5 класса (ВВ Пасечник ) Рабочая тетрадь по биологии для 5 класса (ВВ Пасечник ) (Ответы на вопросы) ГДЗ по биологии 5 класс Пасечник (рабочая тетрадь) gdzlolbizbiologiya- 5 -klass-pasechnik-rabochaya Cached ГДЗ Биология 5 класс Пасечник (рабочая тетрадь) Категория: Биология 5 класс Пасечник Promotional Results For You Free Download Mozilla Firefox Web Browser wwwmozillaorg Download Firefox — the faster, smarter, easier way to browse the web and all of 1 2 3 4 5 Next 17,900

  • ГДЗ по биологии 9 класс Каменский. 1 Биология наука о жизни. 2 Методы исследования в биологии. Каме
  • нский криксунов пасечник. Для ответа на вопросы заданий 4-го и 5-го уровней необходимо проанализировать. Здесь представлены ответы к рабочей тетради по Естествознанию 5 класс Плешаков Сонин. Решебни
  • вать. Здесь представлены ответы к рабочей тетради по Естествознанию 5 класс Плешаков Сонин. Решебник к рабочей тетради по обществознанию 8 класс Котова Лискова. ГДЗ Решебник к рабочей тетради Пасечник Снисаренко Биология 6 класс. Главная 5 класс Рабочая тетрадь по биологии для 5 класса (В.В. Пасечник) ГДЗ по окружающему миру. Вы здесь: Главная Учебники Россия 5 класс Биология 5 класс Пасечник. Рабочая тетрадь по биологии 5 класса Пасечник ГДЗ ( 1 Материал ) Жми! Happy English 5 класс. Enjoy English 7 класс. Решебник ГДЗ Рабочая тетрадь по Биологии 6 класс Пасечник Снисаренко. Предлагаем Вам списать готовые ответы на вопросы к учебнику по биологии за 8 класс Пасечника, Каменский, Швецов, Криксунов . Номера заданий (задач) к ГДЗ удобно читать и смотреть онлайн с телефонов (скачать нельзя). Решебник к рабочей тетради по биологии 6 класс Пасечник, Снисаренко. Авторы: В.В. Пасечник, В.А. Снисаренко. В ГДЗ даны не просто ответы, основанные на полученных знаниях из учебника… Решебники и ГДЗ 5 класс Природоведение спиши онлайн. Рабочая тетрадь по биологии 5 класса Пасечник ГДЗ ( 1 Материал ) Наш онлайн репетитор, бесплатно даст ответы на любые школьные вопросы.

Снисаренко. Авторы: В.В. Пасечник


  • СВ Суматохин
  • Введенский Чтобы в следующий раз не искать сайт — добавь его в закладки ГДЗ по биологии 5 класс рабочая тетрадь Пасечник ответы yagdzcom 5 -klassbiologiya- 5 gdz-po-biologii- 5 Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник Рабочая тетрадь Биология Бактерии
  • Суматохин

Нажмите здесь , если переадресация не будет выполнена в течение нескольких секунд биология класс пасечник тпо гдз Поиск в Все Картинки Ещё Видео Новости Покупки Карты Книги Все продукты ГДЗ рабочая тетрадь по биологии класс Пасечник Дрофа eurokiorg gdz _ klass Решебник по биологии за класс авторы Пасечник издательство Дрофа ГДЗ по биологии класс рабочая тетрадь Пасечник eurokiorg gdz _ klass Решебник по биологии за класс авторы Пасечник издательство Просвещение ГДЗ по биологии класс рабочая тетрадь Пасечник ответы https gdz putinainfo klass gdz Рейтинг , голосов ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от Путина Решебник ГДЗ по биологии класс Пасечник рабочая тетрадь https gdz lolbizbiologiya klass Решебник от Путина по биологии класса для рабочей тетради Пасечника Рабочая тетрадь по биологии класса ВВ Пасечник bio gdz ru klass rabochayatetradpo ГДЗ по биологии для классов Ответы к рабочим Рабочая тетрадь по биологии класса ВВ Пасечник класс Параграф Разнообразие Водоросли Мхи ГДЗ решебник по биологии класс рабочая тетрадь Пасечник https gdz center klass gdz reshebni На сайте GDZ CENTER вы найдете ответы к рабочей тетради Биология класс Пасечник Вы можете смотреть и ГДЗ по биологии за класс рабочая тетрадь ВВ GDZ RU https gdz ru class sumatohintetrad ГДЗ Спиши готовые домашние задания рабочая тетрадь по биологии за класс , решебник ВВ Пасечник , Линия ГДЗ по Биологии за класс рабочая тетрадь ВВ Пасечник gdz _ klass Подробный решебник ГДЗ по Биологии для класса рабочая тетрадь, Авторы учебника ВВ Пасечник , СВ Решебник ГДЗ по биологи класс Пасечник _ klass _ pasechn ГДЗ по биологии за класс Пасечник представляет собой полностью выполненные упражнения, правильно ГДЗ по биологии для класса рабочая тетрадь ВВ gdz klass sumatoh Биология класс Пасечник , Суматохин рабочая тетрадь издательство Просвещение авторы ВВ Пасечник , Гдз класс Рабочая тетрадь по биологии класс Otvetmobi otvetmobirabochayatetradpobiolog Решебник Рабочая тетрадь по биологии класс , авторы ВВ Пасечник Решебник рабочая тетрадь по Биологии за класс ВВ class sumatohin Данное пособие содержит решебник ГДЗ рабочая тетрадь по Биологии за класс Автора ВВ Пасечник , СВ ГДЗ от Путина рабочая тетрадь по биологии класс https gdz putinacc klass pasechnik ГДЗ к рабочей тетради по биологии для класса Пасечник , Суматохин помогут вашему ребенку справиться со ГДЗ рабочая тетрадь по биологии класс Пасечник gdz com gdz klass Подробный решебник ГДЗ к рабочей тетради по биологии класс Пасечник ВВ , онлайн ответы на ГДЗ по биологии для класса ВВ Пасечник https gdz putinarupo klass pasechni Пособие с ГДЗ по биологии класс Пасечник включает решения ко всем упражнениям из двадцати четырех ГДЗ по биологии класс Пасечник ВВ, Суматохин СВ с klass rabochaya ГДЗ по биологии класс Пасечник рабочая тетрадь необходимо для контроля домашнего задания Решебник ГДЗ решебник по биологии для рабочей тетради класс https gdz goorg klass pasechni Рейтинг , голоса Сборник ГДЗ для рабочей тетради по биологии класса Пасечника это учебное пособие, из которого можно ГДЗ к учебнику биологии для класса Пасечник ответы от https gdz life klass biology pasechnik Рейтинг , голосов Подробное ГДЗ к учебнику по биологии для класса , автор Пасечник ВВ Домашние задания на ку с ГДЗ лайф ГДЗ онлайн по Биологии класс Пасечник Решебник gdz netreshebnikbiologiya Заходи и делай уроки с ГДЗ по Биологии класс Пасечник База решебников всегда пополняется ГДЗ номер , страницы , вопросы по биологии класс gdz pasechnik ГДЗ , готовое домашнее задание по биологии класс , автор учебника Пасечник ВВ На Решунове ты всегда ГДЗ ответы рабочая тетрадь по биологии класс Пасечник https gdz georu gdz klass Ответы к рабочей тетради по биологии класс Пасечкин содержат решенные задания и лабораторные работы ГДЗ по биологии класс Пасечник , Суматохин, Калинова reshatorcom gdz klass pasechnik ГДЗ домашнее задание к рабочей тетради по биологии за класс Пасечник , Суматохин, Калинова, Шевцова, Решебник ГДЗ рабочая тетрадь Биология класс Пасечник gdz _ _ class gdz Рейтинг , голосов Решебник ГДЗ рабочая тетрадь Биология класс здорово поможет Вашему ребенку в подготовке домашних ГДЗ по биологии класс рабочая тетрадь Пасечник gdz com gdz biologiya ГДЗ и Решебник к рабочей тетради по биологии за класс , автор Пасечник В В ГДЗ по биологии класс Пасечник klass Готовые ответы для класса по учебнику биологии Пасечника Дрофа Биология , Бактерии, Грибы, Растения, класс , Рабочая окт книгу по лучшей цене со скидкой Биология , Бактерии, Грибы, Растения, класс , Рабочая тетрадь Биология , Бактерии, Грибы, Растения, класс , Рабочая тетрадь, Пасечник ВВ, Ответы на кроссворды Помогите найти решебник по биологии класс к рабочей тетради В В gdz putinaru klass onlajnprirodovedenie gdz reshebnikpobiologii klass rabochayatetrad pasechnik ГДЗ класс Биология Рабочая тетрадь С голубем Сонин klass rabochaya ГДЗ к рабочей тетради по биологии С голубем Сонин, Плешаков для класса ГДЗ по Биологии класс Пасечник УрокиТВ Решебник с kla Не можешь найти правильный ответ? Смотри ГДЗ по Биологии класс Пасечник Канал на YouTube ГДЗ , Ответы к рабочей тетради по Биологии класс Пасечник https gdz naru gdz otvetykrabochej авг Нагрузка на нынешних учеников возрастает с их переходом в класс К дисциплинам начальной Ответы к рабочей тетради по биологии класс Пасечник klass rabochayatetrad Ответы на вопросы к рабочей тетради по биологии для класса Автор учебника ВВ Пасечник ГДЗ для класса по предмету Биология https gdz chat _ klass biology Биология класс Рабочая тетрадь Плешаков, Сонин Дрофа Биология класс Пасечник Биология класс ГДЗ и Решебник по биологии для класса Пасечник dedbotancom gdz biologiya klass Решебник по биологии рабочая тетрадь для класса Пасечник Суматохин Калинова Швецов на dedbotancom ГДЗ по биологии класс Пасечник на ЛОЛ КЕК lolkekrubiologiya klass pasechnik html Готовые ответы для класса по учебнику биологии Пасечника Дрофа Мегарешеба ГДЗ по Биологии за класс Пасечник В В gdz class Убедись в правильности решения задачи вместе с ГДЗ по Биологии за класс Пасечник В В, Суматохин СВ, Гдз по Биологии за класс рабочая тетрадь, авторы https gdz ometrcom gdz rabochay Готовые ответы помогут Вам сверить задание по Биологии Рабочая тетрадь за класс , от автора Корнилова Учебники по Биологии , рабочие тетради купить в Самаре Биология класс Введение в Биология класс Введение в общую биологию Рабочая тетрадь Пасечник ГДЗ решебник по Биологии класс Рабочая тетрадь gdz freeru gdz Bi Готовое Домашнее Задание ГДЗ решебник по Биологии класс Рабочая тетрадь Пасечник Ваша домашняя ГДЗ по биологии класс Сонин рабочая тетрадь https gdz roomorgbiologiya klass Здесь расположены готовые домашние задания по биологии за класс Рабочая тетрадь создана для учебника класс ZUBRILANET zubrilanetbooksbiologiya klass Скачать бесплатно Тесты по биологии класс К учебникам Плешакова Пасечник ВВ, Суматохин СВ и др ГДЗ по биологии класс Пасечник учебник и рабочая тетрадь gdz pobiologii ноя гдз по математике класс бунимович ГДЗ по биологии класс Пасечник учебник и рабочая ГДЗ по биологии класс рабочая тетрадь Пасечник ответы gdz com klass gdz po ГДЗ решебник рабочая тетрадь Биология Бактерии, грибы, растения класс В В Пасечника с шишкой ФГОС ГДЗ ЛОЛ по Биологии за класс , спиши ответ онлайн https gdz lolbiologiya klass Решебник поможет получить отличную оценку Биология класс Пасечник , Суматохин рабочая тетрадь ГДЗ и решебник по биологии для класса Пасечник к https gdz otvetyreshebnikicom ГДЗ и решебник Биология класс рабочая тетрадь ответы Авторы учебника рабочей тетради Пасечник ГДЗ Решебник по биологии класс Пасечник , Суматохин gdz putinabiz gdz gdz reshebnikpo Предлагаем Вам списать готовые ответы на вопросы к рабочей тетради по биологии за класс Пасечник , ГДЗ по биологии класс Пасечник учебник ответы new gdz net gdz klass pasechnik Решебник на домашние задания по биологии за класс на учебник Пасечник ВВ, Суматохин СВ, Калинова Картинки по запросу биология класс пасечник тпо гдз Биология наука о живой природе Видеоурок по биологии сен Пройти тест по теме Перейти к Видеоурок по биологии класс myoutubecom Строение клетки Видеоурок по биологии класс YouTube сен Пройти тест по теме Перейти к тренажерам ruAmMz myoutubecom Строение клетки Ткани Биология класс Инфоурок окт Строение клетки Ткани Биология класс Инфоурок Published on Oct , Видеоуроки myoutubecom В ответ на жалобы, поданные в соответствии с Законом США Об авторском праве в цифровую эпоху , мы удалили некоторые результаты с этой страницы Вы можете ознакомиться с жалобами на сайте LumenDatabaseorg Жалоба , Жалоба Запросы, похожие на биология класс пасечник тпо гдз рабочая тетрадь по биологии класс пасечник скачать рабочая тетрадь по биологии класс пасечник суматохин скачать рабочая тетрадь по биологии класс пасечник линия жизни скачать гдз по биологии класс диагностические работы пасечник гдз по биологии класс рабочая тетрадь пасечник гдз лол биология класс пасечник параграф гдз по биологии класс рабочая тетрадь корнилова ягдз гдз по биологии класс иванова След Войти Версия Поиска Мобильная Полная Конфиденциальность Условия Настройки Отзыв Справка

ГДЗ по биологии 9 класс Каменский. 1 Биология наука о жизни. 2 Методы исследования в биологии. Каменский криксунов пасечник. Для ответа на вопросы заданий 4-го и 5-го уровней необходимо проанализировать. Здесь представлены ответы к рабочей тетради по Естествознанию 5 класс Плешаков Сонин. Решебник к рабочей тетради по обществознанию 8 класс Котова Лискова. ГДЗ Решебник к рабочей тетради Пасечник Снисаренко Биология 6 класс. Главная 5 класс Рабочая тетрадь по биологии для 5 класса (В.В. Пасечник) ГДЗ по окружающему миру. Вы здесь: Главная Учебники Россия 5 класс Биология 5 класс Пасечник. Рабочая тетрадь по биологии 5 класса Пасечник ГДЗ ( 1 Материал ) Жми! Happy English 5 класс. Enjoy English 7 класс. Решебник ГДЗ Рабочая тетрадь по Биологии 6 класс Пасечник Снисаренко. Предлагаем Вам списать готовые ответы на вопросы к учебнику по биологии за 8 класс Пасечника, Каменский, Швецов, Криксунов . Номера заданий (задач) к ГДЗ удобно читать и смотреть онлайн с телефонов (скачать нельзя). Решебник к рабочей тетради по биологии 6 класс Пасечник, Снисаренко. Авторы: В.В. Пасечник, В.А. Снисаренко. В ГДЗ даны не просто ответы, основанные на полученных знаниях из учебника… Решебники и ГДЗ 5 класс Природоведение спиши онлайн. Рабочая тетрадь по биологии 5 класса Пасечник ГДЗ ( 1 Материал ) Наш онлайн репетитор, бесплатно даст ответы на любые школьные вопросы.

Гдз биология рабочая тетрадь задорожный. Рабочая тетрадь по биологии. Биология

  • Биология с решебником: к вершинам знаний с настоящим волшебником!
  • Что такое ГДЗ и почему педагоги рекомендуют использовать подобные издания? Стоит ли полагаться на решебник тем, кто хочет учиться, или это шпаргалка для лентяев? Во все времена школьники сетовали на нелегкую жизнь, однако именно учеба помогает человеку развиваться и совершать новые открытия. Ученик 7 класса еще не осознает последствий пробелов в занятиях и нуждается в наставлениях. К числу дисциплин, которыми многие учащиеся стремятся пренебречь, относится биология. Этот предмет прослыл в их среде узкоспециализированным, а ведь именно он способен раскрыть секреты и тайны окружающего мира.
  • В 7 класс с

    ГДЗ по биологии: дорога, вымощенная знаниями
  • Что мешает школьнику делать уроки? По мнению специалистов, причинами нерадивого отношения к учебе являются не лень и разгильдяйство, а апатия, вызванная отсутствием интереса и неудачами. Исправить ситуацию поможет решебник! Рабочая тетрадь по биологии С.В. Суматохина и В.С. Кучменко – это:
    — доступные и понятные тексты;
    — репродуктивные и творческие задания;
    — познавательные задачи;
    — логичные таблицы, графики и схемы;
    — наглядные иллюстрации и увлекательные кроссворды.
  • Биология с таким помощником превратится в любимый предмет. Используйте онлайн ответы с умом. Путь к знаниям нелегок, но с ГДЗ он станет менее тернистым!
  • Биология 7-й класс — актуальные практикумы и решебники к ним

  • Биология открывает семиклассникам подробный мир живых организмов. Раздел зоология, по отзывам школьников, один из наиболее интересных и познавательных. Узнать о жизни насекомых, птиц, животных можно подробно и полно, если вдумчиво и ответственно подходить к изучению биологии в седьмом классе. Помочь в этом смогут качественные учебные материалы по дисциплине и решебники к ним. Составляя план работы, следует ориентироваться на собственные задачи и цели. В их числе — повышение текущего балла, подготовка к участию в предметных олимпиадах и конкурсах и другие.
  • Помочь реализовать любые из вышеперечисленных целей позволят занятия по ГДЗ — регулярные и системные. Проводить их следует, исходя из:
    — собственного базового уровня подготовленности;
    — заинтересованности и поставленных задач;
    — количества времени, которое семиклассники могут и способны выделить регулярно для работы с пособиями;
    — базового курса УМК, программы, по которому осуществляется подготовка в школе.
  • В числе эффективных программ многие называют систему «Алгоритм успеха», составленную группой авторов. Помимо хорошей систематизации материала, логичной и подробной, понятной системы изложения, её отличает универсальность. То есть, практикумы из этого УМК оптимально подходят для работы с теоретическими учебниками других программ по биологии для 7-го класса.
  • Среди интересных и полезных сборников-практикумов «Алгоритма успеха» эксперты выделяют рабочую тетрадь по биологии для 7 класса, составленную Суматохиным С. В. и Кучменко В. С. Сборник позволяет грамотно и уверенно отработать на практике все полученные на уроках теоретические знания, проверить усвоение материала, найти пробелы и проблемы и своевременно, оперативно их устранить. Материалы, представленные в пособии, наглядные и эффективные.
  • Рабочая тетрадь этих авторов нередко рекомендуется выпускникам 9-х и 11-х классов, избравших для сдачи на итоговых испытаниях — ОГЭ/ЕГЭ биологию для повторения материала из курса зоологии, изучаемого в седьмом классе школы. Также подходит репетиторам, осуществляющим подготовку выпускников к экзаменам и школьников любого класса старшей ступени школы к предметным олимпиадам по биологии, проводимым на школьных и внешкольных площадках.

Поможет получать пятерки любому школьнику ГДЗ по биологии рабочая тетрадь 9 класс Пасечник В. В. Далеко не каждый ученик осознает, что от качества его школьного обучения зависит вся его дальнейшая жизнь. Большинство детей и подростков относятся к одиннадцати классам как к долгосрочному наказанию. На самом деле, то, как человек показывает себя в данный период сильно влияет на его будущую карьеру. Если обратиться к статистике, то можно заметить весьма любопытные факты. Так, все бюджетные места в престижных университетах страны занимают отличники и, куда реже, хорошисты. Они получают красный диплом, а с ним идут устраиваться на престижные должности в крупные фирмы или государственные учреждения. Многие и вовсе начинают свой, довольно успешный, бизнес. Связано это с тем, что эти люди — одни из самых дисциплинированных, трудолюбивых и ответственных: они никогда не бросают дело на полпути. Кроме того, есть своеобразные бонусы в том, чтобы иметь превосходный аттестат:

  1. Им сходят с рук пропущенные уроки и не написанные проверочные работы. Связано это с тем, что учителя прекрасно знают, что они смогут наверстать весь пропущенный материал.
  2. Они практически не знают что такое волнение на тестах. Холодному разуму, стойкости и умению собираться в критических ситуациях их научил опыт посещения множества олимпиад и конкурсов. Участие в них также может принести неплохие бонусы в вузе: к примеру, повышенную стипендию или гранты.
  3. С ними хотят дружить почти все, т.к. они могут дать списать на контрольной работе. Они пользуются настоящим авторитетом среди своих сверстников.

Как преодолеть трудности с пособием по биологии для рабочей тетради за 9 класс от Пасечника

Чтобы добиться такого положения, необходимо стараться. Так, школьник обязан посещать каждое занятие, выполнять любое упражнения — только так рабочая программа будет усвоена. Важно вовремя устранять пробелы в знаниях. К примеру, часто они возникают с таким предметом как алгебра. Царица наук не терпит забытых правил — все нужно учить наизусть. Однако делать этого не придется — достаточно просто открыть ГДЗ по учебнику Пасечника В.В. ФГОС за 9 класс онлайн. В решебнике по биологии для 9 класса, рабочая тетрадь, авторы: В.В. Пасечник, Г.Г. Швецов есть:

  1. Верные ответы на любой номер.
  2. Подробные решения заданий.
  3. Есть и выполненные контрольные работы.

Рабочая тетрадь является составной частью учебно-методического комплекта серии «Линия жизни» для 5-6 классов под редакцией В. В. Пасечника и адресована учащимся, занимающимся по учебнику этой линии.
Структура пособия соответствует тематической структуре учебника «Биология. 5-6 классы» и содержит разнообразные вопросы и задания, направленные на отработку широкого спектра необходимых умений. В пособие также включены задания для контроля, которые помогут лучше подготовиться к проверке знаний.
Пособие предназначено для самостоятельной работы учащихся дома или на уроке.

Тетрадь является приложением к учебнику В. В. Пасечника «Биология. Бактерии, грибы, растения. 5 класс». Учебник соответствует Федеральному государственному образовательному стандарту основного общего образования. Помимо тетради в состав УМК входят электронное приложение, методическое пособие и рабочая программа.
Тетрадь содержит различные репродуктивные и творческие вопросы и задания, в том числе в виде лабораторных работ, познавательных задач, таблиц, схем, рисунков и терминологических кроссвордов. В тетрадь включены также тестовые задания, которые помогут ученикам подготовиться к успешной сдаче ЕГЭ и ГИА.
Специальными знаками отмечены задания, направленные на формирование метапредметных умений (планировать деятельность, выделять различные признаки, сравнивать, классифицировать и др.) и личностных качеств учеников.

Скачать и читать Биология, Бактерии, Грибы, Растения, 5 класс, Рабочая тетрадь, Пасечник В.В., 2015

Предлагаемая тетрадь — часть учебного комплекса к учебнику Н. и. Сонина «Биология. Живой организм. 6 класс». Специальными знаками отмечены задания, направленаые на формирование метапредметных умений (планировать деятельность, выделять различные признаки, сравнивать, классифицировать и др. ) и личностных качеств учеников.
Материал в тетради расположен в той же последовательности, что и в учебнике. В конце каждого раздела помещена рубрика «Тренировочные задания», вопросы которой составлены по форме и с учетом требований ЕГЭ. Работа с тетрадью поможет учащимся лучше освоить содержание курса.
Учебник соответствует (Федеральному образовательному стандарту основного общего образования. Помимо тетради в состав УМК входят электронное приложение, методическое пособие и рабочая программа.

Рассмотрите рисунки цветков. Найдите на них цветоножку, цветоложе, чашелистики, лепестки, тычинки, пестики (с завязью, столбиком и рыльцем) и раскрасьте каждую часть цветка одним цветом (например, чашечки — зелёным, венчики — жёлтым и т. д.).

Скачать и читать Биология, живой организм, 6 класс, рабочая тетрадь к учебнику Сонина Н.И. «Биология, Живой организм, 6 класс», Сонин Н.И., 2014

Рабочая тетрадь разработана к учебнику «Основы общей биологии» для учащихся 9 класса (авт. И.Н. Пономарева, О.А. Корнилова, Н.М. Чернова). Предлагаемые в ней задания, имеющие различный познавательно-обучающий характер, соответствуют названным разделам и параграфам учебника. Они позволят учителю организовать дифференцированную практическую работу девятиклассников, а ученикам — приобрести качественные знания по общей биологии.

Скачать и читать Биология, 9 класс, Рабочая тетрадь, Козлова Т.А., Кучменко В.С., 2013

Предлагаемая тетрадь — часть учебного комплекта к учебнику В. Б. Захарова, Н. И. Сонина «Биология. Многообразие живых организмов». В нее включены разнообразные вопросы, задания, лабораторные работы.
Материал в тетради располагается в той же последовательности, что и в учебнике. Работа с тетрадью поможет ученикам лучше усвоить содержание учебника и подготовиться к успешной сдаче ЕГЭ и ГИА при помощи тестовых заданий, включенных в рабочую тетрадь.

Скачать и читать Биология, Многообразие живых организмов, 7 класс, Рабочая тетрадь, Захаров В. Б., Сонин Н.И., 2014

Рабочая тетрадь является дополнением к учебникам В. Б. Захарова, С.Г. Мамонтова, Н. И. Сонина, Е. Т. Захаровой «Биология. Общая биология. Профильный уровень, 10 класс» и «Биология, Общая биология. Профильный уровень. 11 класс».

Рабочая тетрадь позволит лучше усвоить» систематизировать и закрепить знания, полученные при изучении материала учебника.

В конце тетради помещены «Тренировочные задания», составленные по форме и с учетом требований ЕГЭ, которые помогут учащимся лучше усвоить содержание курса.

  • Почему преподаватели рекомендуют использовать решебники? Что такое ГДЗ – онлайн шпаргалка или незаменимый в обучении инструмент? На эти и другие вопросы школьники и их родители легко ответят сами, получив в свое распоряжение практичное издание.
  • Рабочие тетради предлагаются в качестве эффективного подспорья в учебе. Дидактические комплексы-практикумы – ежедневный арсенал педагога, умелый наставник для школьника и справочник для подзабывших школьную программу родителей. Наличие готовых ответов – не что иное, как «путеводная нить» для каждой из категорий.
  • Для подготовки домашних работ в 9 классе рекомендуется использовать пособие, которое составили В.В. Пасечник, Г.Г. Швецов. Авторы приложили все усилия, чтобы каждый нашел в издании нужное и полезное:
    — педагоги – поурочный учебный комплекс;
    — школьник – инструмент для шлифовки знаний;
    — родители – возможность проверить домашние задания.
  • Уроки биологии в 9 классе охватывают объемный учебный материал: от молекулярной теории до эволюционных гипотез. Школьники не только продолжают познавать мир, но и знакомятся с азами исследовательской деятельности.
  • ГДЗ – это возможность закрепить усвоенную на уроках информацию, применить её на практике и проверить полученные результаты. Правильный подход к использованию решебника принесет толк, неправильный – усугубит проблемы. Выбор за вами!
  • Биология — девятиклассникам: эффективные рабочие тетради и решебники

  • Занимаясь по рабочей тетради по биологии для 9 класса, составленной Пасечником В. В. и Швецовым Г. Г. и выпущенной издательством Дрофа, учащиеся получат полное и глубокое, проработанное на практике представление о таких разделах и темах курса, как:
    — роль и место биологии в системе современных наук, методы проводимых биологических исследований;
    — основополагающие понятия и принципы науки о клетке — цитологии, клеточные теории и химический состав основного элемента всех живых организмов на планете, протекающие в клетках процессы — обмен веществ, биосинтез белка и другие;
    — понятие организмов, их индивидуальное развитие и размножение, способы и особенности процессов;
    — генетика, её закономерности и формы, теории и их практическая проверка.
  • Используя специальный решебник к пособию, девятиклассники смогут самостоятельно, в своем темпе и исходя из своих задач и целей, составить эффективный план работы и достичь желаемого. В основе такого планирования работы с ГДЗ должны лежать:
    — оценка базового уровня знаний школьника;
    — результат, который он стремится достигнуть такой работой — участие и победа в олимпиадах по предмету, улучшение текущего и итогового балла по биологии, подготовка к сдаче ОГЭ по этой дисциплине;
    — самоконтроль и самопроверка достижений, выявление и своевременное исправление возникающих недостатков, устранение проблем, корректировка планов.
  • Работать с помощью сборников готовых домашних заданий девятиклассники могут самостоятельно или привлекая в помощь специалистов — репетиторов и руководителей подготовительных курсов и кружков по биологии. Еще одно важное преимущество такой методики — постоянное наблюдение принципа грамотной записи результатов. Часто верно полученный, но неправильно отображенный ответ ведет к снижению балла, а на конкурсах, олимпиадах и аналогичных мероприятиях — к потере призового места, проигрышу. Работа же с готовыми домашними заданиями в регулярном режиме позволит избавиться от подобного риска, главное — быть внимательным не только к решению, но и к написанию результатов.
  • Сборник рекомендован многими экспертами и специалистами, нередко используется выпускниками одиннадцатого класса, готовящимися сдавать ЕГЭ по биологии для повторения непростого и объемного материала курса девятого класса.

Страница не найдена


13 авг

Единовременные выплаты к школе получили родители 19,4 млн детей в России, сообщает ТАСС со ссылкой на Минтруд.

12 авг

Губернатор американского штата Орегон Кейт Браун подписала законопроект, согласно которому от выпускников старших классов в штате больше не будут требовать хороших навыков чтения, письма и математики. По мнению местных властей, инициатива должна помочь «цветным учащимся» чувствовать себя свободнее в США. Закон вызвал сильное недовольство у многих жителей Орегона, американские политики назвали его ударом по всей системе образования.

12 авг

Врач-педиатр АО «Медицина» кандидат медицинских наук Екатерина Морозова рассказала, как помочь детям справиться с «синдромом 1 сентября».

12 авг

Глава Национального союза производителей школьной и форменной одежды Александра Алдушина прокомментировала исследование Роскачества о рубашках для мальчиков.

12 авг

Роскачество провело исследование рубашек для мальчиков-школьников. В рамках соответствующей работы специалисты организации изучили продукцию 35 брендов.

12 авг

Российский лидер Владимир Путин в ходе встречи в режиме видеоконференции с временно исполняющим обязанности главы Тувы Владиславом Ховалыгом обсудил вопросы профилактики туберкулёза и рака, а также указал на сорванные сроки по ликвидации аварийного жилья в республике.

12 авг

Первый заместитель председателя Общественной палаты Ленинградской области Владимир Петров предложил рассмотреть идею внедрения ежегодной практики заморозки цен в период с конца августа до середины сентября на самые популярные «школьные» сорта цветов. Копия обращения на имя министра промышленности и торговли Дениса Мантурова есть в распоряжении RT.

▶▷▶▷ гдз по биологии 5 класс пасечник фгос рабочая тетрадь

▶▷▶▷ гдз по биологии 5 класс пасечник фгос рабочая тетрадь
Тип лицензияFree
Кол-во просмотров257
Кол-во загрузок132 раз

гдз по биологии 5 класс пасечник фгос рабочая тетрадь — ГДЗ по биологии 5 класс рабочая тетрадь Пасечник gdz-putinainfo 5 -klassprirodovedenie- 5 gdz Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник ответы ГДЗ готовые домашние задания к рабочей тетради Биология 5 класс Пасечник ФГОС от Путина 415 (389) ГДЗ по биологии 5 класс рабочая тетрадь Пасечник ответы yagdzcom 5 -klassbiologiya- 5 gdz-po-biologii- 5 Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник Рабочая тетрадь Биология Бактерии, грибы, растения 5 класс В В Пасечника с шишкой Рабочая тетрадь к учебнику по биологии пасечника 5 класс gdzlolru 5 -klassrabochaya-tetrad-k-uchebniku Cached Содержание Биология 5 класс Рабочая тетрадь ПасечникГДЗ по биологии за 5 класс рабочая тетрадь ВВ Пасечник , СВ СуматохинГДЗ по Биологии за 5 класс рабочая тетрадь ВВ Пасечник , СВ Суматохин, ГС Калинова, ГГ ГДЗ Биология 5 класс Пасечник — Рабочая тетрадь gdzchat 5 _klassbiologyrabochaya_tetrad_po Cached Рабочая тетрадь 5 класс Пасечник поможет справиться со всеми препятствиями Издательский дом Дрофа, 2014 г Что в него включено ГДЗ ЛОЛ за 5 класс по Биологии Пасечник ВВ рабочая тетрадь ФГОС gdzlolbiologiya 5 -klasspasechnik-tetrad Cached Выполнения задания за 5 класс по Биологии Пасечник ВВ рабочая тетрадь , от издательства: Дрофа 2019 ФГОС , не простое занятие Гдз По Биологии 5 Класс Пасечник Фгос Рабочая Тетрадь — Image Results More Гдз По Биологии 5 Класс Пасечник Фгос Рабочая Тетрадь images Биология Бактерии, грибы, растения 5 класс Рабочая тетрадь wwwlabirintrubooks340657 Cached Бактерии, грибы, растения 5 класс Рабочая тетрадь к учебнику ВВ Пасечника ФГОС (автор Пасечник Владимир Васильевич), пишите об этом в сообщении об ошибке Спасибо! 345 (10) ГДЗ Биология 5 класс Рабочая тетрадь Пасечник В В otlgdzonline 5 -klassbiologiya- 5 gdz-biologiya Cached ГДЗ на Отлично 5 КЛАСС ГДЗ по биологии для 5 класса ГДЗ Биология 5 класс Рабочая тетрадь Пасечник В В Рабочая тетрадь по биологии для пятиклассников идет в комплекте с учебником пасечника 355 (87) Решебник (ГДЗ) по биологии за 5 класс megareshebarupublgdzbiologija 5 _klass107-1 Cached Подробный решебник ( гдз ) по Биологии за 5 класс к учебнику школьной программы ГДЗ по биологии 5 класс рабочая тетрадь Пасечник Суматохин gdz-putinainfo 5 -klassprirodovedenie- 5 gdz Cached ГДЗ по биологии 5 класс рабочая тетрадь Пасечник Суматохин ГДЗ готовые домашние задания рабочей тетради по биология 5 класс Пасечник , Суматохин, Калинова, Швецов, Гапонюк Просвещение Линия 425 (102) Биология 5 класс рабочая тетрадь Пасечник ВВ ФГОС — купить rosuchebnikruproductbiologiya-bakterii-griby Cached Рабочая тетрадь по биологии 5 класс Пасечника ВВ в наличии в печатной и электронной форме по выгодной цене издательства Дрофа Тетрадь соответствует ФГОС , содержит тестовые задания к ЕГЭ 1 2 3 4 5 Next 45,700

  • Рабочая тетрадь по биологии 5 класса (В.В. Пасечник). 1. Биология наука о живой природе 2. ГДЗ, ре
  • шебники онлайн. Каталог учебников. Решение квадратных уравнений онлайн. Главная 5 класс Биология ГДЗ — Рабочая тетрадь по Биологии 5 класс Пасечник. Обложки для тетрадей и книг. Рабочая тетрадьquo
  • ГДЗ — Рабочая тетрадь по Биологии 5 класс Пасечник. Обложки для тетрадей и книг. Рабочая тетрадьquot; Пасечник, Калинова. Рабочая тетрадь издательства quot;Просвещениеquot; формата А-5, обложка — картон, листы — белые, скрепленные скрепкой, 80 страниц, шрифт — средний, черно-белые иллюстрации. Вы можете смотреть и читать гдз онлайн (без скачивания) с компьютера и мобильных устройств. Гдз решебник по биологии 5 класс рабочая тетрадь пасечник. Выберите номер задания тетради: Не нашел, что искал? Перейти к гдз рабочая тетрадь по биологии пасечник 5 класс. Рабочая тетрадь. К учебнику В.В. Пасечника quot;Биология. 5 класс, переработанному в соответствии с требованиями ФГОС и составляет с ним единый Учебно-Методический Комплект.. Пособия практичны, отвечают требованиям ФГОС к содержанию и оформлению. Здесь представлены ответы к рабочей тетради Биология 5 класс Пасечник. На reshebnikgdz.ru Вы можете скачать Решебник (ГДЗ) по истории 5 класс рабочая тетрадь Годер. Главная 5 класс Рабочая тетрадь по биологии для 5 класса (В.В. Пасечник) ГДЗ по окружающему миру. УМК В.В. Пасечник.Биология.5 класс.:учеб.для общеобразоват.учреждений-Москва.:Просвещение,2012. Скачать: рабочая программа по биологии 5 класс (фгос. пасечник в.в. линия жизни ).

обложка — картон

скрепленные скрепкой

  • грибы
  • растения 5 класс Рабочая тетрадь к учебнику ВВ Пасечника ФГОС (автор Пасечник Владимир Васильевич)
  • от издательства: Дрофа 2019 ФГОС

гдз по биологии класс пасечник фгос рабочая тетрадь Поиск в Нажмите здесь , если переадресация не будет выполнена в течение нескольких секунд Все Картинки Новости Покупки Карты Видео Книги Инструменты поиска На всех языках На всех языках Только на русский За всё время За всё время За час За часа За неделю За месяц За год Все результаты Все результаты Точное соответствие ГДЗ рабочая тетрадь по биологии класс Пасечник Дрофа класс ФГОС Пасечник Дрофа ГДЗ рабочая тетрадь по биологии класс Пасечник Дрофа Биология признается одной Рабочая тетрадь по биологии класс ФГОС Пасечник класс ГДЗ БиологияОкр мир класс Рабочая тетрадь по биологии класс ФГОС Пасечник Просвещение ГДЗ по биологии класс рабочая тетрадь Пасечник ответы prirodovedenie ГДЗ ответы на вопросы к рабочей тетради Биология класс Пасечник ФГОС решебник от Путина ГДЗ по биологии класс рабочая тетрадь Пасечник prirodovedenie ГДЗ ответы на вопросы рабочей тетради по биология класс Пасечник, Суматохин, Калинова, Швецов, Гапонюк Просвещение Линия жизни ФГОС решебник от Путина ГДЗ по биологии класс рабочая тетрадь ВВ Пасечник, СВ класс Биология ГДЗ готовые ответы по биологии рабочая тетрадь за класс, решебник ВВ Пасечник, Линия жизни ФГОС, ГДЗ по биологии класс ВВ Пасечник Решебник класс Биология ГДЗ готовые ответы по биологии за класс, решебник ВВ Пасечник, ФГОС, онлайн решения на GDZRU ГДЗ по биологии класс Пасечник рабочая тетрадь biologiyaklasspase Решебник от Путина по биологии класса для рабочей тетради Пасечника Рабочая тетрадь по биологии класса ВВ Пасечник klass rabochayate ГДЗ по биологии для классов Ответы к рабочим тетрадям Рабочая тетрадь по биологии класса ВВ Пасечник класс с шишкой Введение Методы исследования в биологии Решебник ГДЗ по биологии за класс класс Подробный решебник гдз по Биологии за класс к учебнику школьной программы автор ВВ Пасечник Биология класс рабочая тетрадь тип Алгоритм успеха часть , ФГОС ГДЗ решебник по биологии класс рабочая тетрадь Пасечник prirodovedenie g На сайте GDZCENTER вы найдете ответы к рабочей тетради Биология класс Пасечник Вы можете смотреть и ГДЗ по биологии для класса ВВ Пасечник klass pasechnik ГДЗ по биологии класс ВВ Пасечник ГДЗ к рабочей тетради по биологии за класс Пасечник ВВ можно ГДЗ по биологии для класс от Путина pobiologii klass Биология класс Пасечник Биология класс автор ВВ Пасечник Биология класс рабочая тетрадь Сухова биология гдз пятый класс пасечник arkaimavtoru store file biologiiag авг г задания к рабочей тетради Биология класс Пасечник ФГОС от Путина ГДЗ по биологии Биология класс рабочая тетрадь Пасечник ВВ ФГОС product biolog Рабочая тетрадь по биологии класс Пасечника ВВ в наличии в печатной и электронной форме по выгодной Биология, Бактерии, Грибы, Растения, класс, Рабочая biologiyabakteriigr окт г Биология, Бактерии, Грибы, Растения, класс, Рабочая тетрадь, Пасечник В В, Биология класс Рабочая тетрадь к учебнику В В reviews goods Рецензии на книгу Биология класс Рабочая тетрадь к учебнику В В Пасечника ФГОС Наталья ГДЗ ответы рабочая тетрадь по биологии класс Пасечник klass pasechnik Справочники ОГЭ ЕГЭ ГДЗ класс Решенная рабочая тетрадь по биологии класс Пасечник ФГОС ГДЗ по биологии для класса рабочая тетрадь ВВ Суматохин Биология класс Пасечник, Суматохин рабочая тетрадь издательство Просвещение авторы ВВ Пасечник, Богданов НА Рабочая тетрадь по биологии класс К productbo От , р до , р класс К учебнику ВВ Пасечника Биология классы УМК Линия жизни ФГОС в отзывах покупателей, гдз по биологии класс пасечник рабочая тетрадь часть ayufoodscom upload gdzpobiologi нояб г часть ФГОС ГДЗ Биология класс Рабочая тетрадь Пасечник В В otlgdzonline КЛАСС ГДЗ по гдз по биологии в рабочей тетради класс пасечник SEAE seaembuorg imagens gdzpobiologi ПриродБиология ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от гдз по биологии класс рабочая тетрадь часть пасечник ecvalarru uploads gdzpobiologii нояб г гдз по биологии класс рабочая тетрадь часть пасечник Природ Биология ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от гдз решения по биологии класс автолюбительрф userfiles gdzresh окт г ответы ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС решебник по биологии класс рабочая тетрадь пасечник wwwzstelceu content file reshebni нояб г готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от Путина гдз по биологии класс рабочая тетрадь пасечник Dfaktilv wwwdfaktilv images File gdzpo нояб г гдз по биологии класс рабочая тетрадь пасечник и суматохин класс Биология ГДЗ решебник ответы к учебнику по биологии класс Пасечник Суматохин Калинова ФГОС гдз по биологии по печатной тетради класс пасечник dushkzru uploads fck gdzpobiol нояб г Тут отличные гдз по биологии рабочая тетрадь для класса биологии для классов Ответы к Рабочая тетрадь тетради Биология класс Пасечник Снисаренко ФГОС гдз биология пасечник класс рабочая тетрадь wwwtourbikepl userfiles gdzbiolog дек г гдз биология пасечник класс рабочая тетрадь биологии класс Пасечник Суматохин Калинова ФГОС от ГДЗ Рабочая тетрадь по Биологии класс Пасечник Все гдз рабочая тетрадь по биологии класс пасечник дрофа wwwcsaladihaztervezeshu Files File нояб г ГДЗ по биологии класс рабочая тетрадь Пасечник yagdzcom класс Биология ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от гдз раб тетр по биологии класс Litchfield BZ wwwlitchfieldbz images gdzrabtetr окт г рабочей тетради Биология класс Пасечник ФГОС от Путина ГДЗ по биологии класс рабочая гдз биология тетрадь класс пономарева scroru pic gdzbiologiiatetradkla сент г Главная класс Рабочая тетрадь по биологии для класса Корнилова ОА, Николаев класс гдз по биологии рабочая тетрадь класс пасечник фгос с cdosferarinethostru gdz гдз по биологии класс рабочая тетрадь бактерии грибы hotelgariccom upload gdzpobiolog Пасечник yagdzcom класс Биология ГДЗ решебник к рабочей тетради по биологии класс Пасечник ФГОС биология класс рабочая тетрадь пасечник и снисаренко гдз asppermru content biologiiaklass нояб г биология класс рабочая тетрадь пасечник и биология класс рабочая тетрадь пасечник и снисаренко гдз по биологии класс Пасечник Суматохин Калинова ФГОС от Гдз по Биологии за класс рабочая тетрадь, авторы kl rabochaya по Биологии Рабочая тетрадь за класс, от автора Корнилова ОА, Николаев ИВ, Симонова ЛВ ФГОС Гдз по биологии класс рабочая тетрадь пасечник gdzpobiologiiklassrabochayatetradpasechniksumatohinfortunafishrfru Ответы по биологии класс Пасечник рабочая тетрадь ГДЗ по биологии тетради по биологии класс Пасечник Суматохин Калинова ФГОС forward класс решебник verbitskaya Решебник по биологии класс часть пасечник reshebnikpobiologiiklasschastpasechnikfortunafishrfru июн г ГДЗ готовые домашние задания к рабочей тетради Биология класс Пасечник ФГОС от Все решебники ГДЗ за класс Reshakru tag klass ГДЗ рабочей тетради Enjoy English класс ФГОС Рабочая ГДЗ по Биологии класс Пасечник Химический состав клетки Биология класс Инфоурок watch Продолжительность Опубликовано окт г Картинки Показать все Показать все ГДЗ по биологии класс ТПО Пасечник Подробные ГДЗ rossoneroru biologii gdzpobiologii ГДЗ Рабочая тетрадь по биологии класс Пасечник ГДЗ Биология класс Рабочая тетрадь Пасечник В В ФГОС Пасечник Дрофа Изображения обложек учебников приведены на Гдз по биологии класс рабочая тетрадь modelru modelru gdzpobiologiiklassra окт г скачивания онлайн ГДЗ решебник к рабочей тетради по биологии класс Пасечник Суматохин Калинова Швецов ФГОС с ракушкой улиткой Просвещение Линия жизни ГДЗ ЛОЛ за класс по Биологии Пасечник В В klass sumatohin Выполнения задания за класс по Биологии Пасечник В В, Суматохин С В, Калинова ГС, Гапонюк ЗГ , от Мы скрыли некоторые результаты, которые очень похожи на уже представленные выше Показать скрытые результаты В ответ на официальный запрос мы удалили некоторые результаты с этой страницы Вы можете ознакомиться с запросом на сайте LumenDatabaseorg В ответ на многочисленные жалобы, поданные в соответствии с Законом США Об авторском праве в цифровую эпоху DMCA, мы удалили некоторые результаты с этой страницы Вы можете ознакомиться с жалобами на сайте LumenDatabaseorg Жалоба и Жалоба Похожие запросы биология пятый класс рабочая тетрадь гдз по биологии класс рабочая тетрадь пасечник гдз лол биология класс рабочая тетрадь пасечник суматохин калинова швецов гапонюк рабочая тетрадь по биологии класс пасечник скачать рабочая тетрадь по биологии класс пасечник линия жизни скачать рабочая тетрадь по биологии класс пасечник суматохин скачать биология класс рабочая тетрадь корнилова скачать гдз по биологии класс рабочая тетрадь новикова Войти Настройки Конфиденциальность Условия

Рабочая тетрадь по биологии 5 класса (В.В. Пасечник). 1. Биология наука о живой природе 2. ГДЗ, решебники онлайн. Каталог учебников. Решение квадратных уравнений онлайн. Главная 5 класс Биология ГДЗ — Рабочая тетрадь по Биологии 5 класс Пасечник. Обложки для тетрадей и книг. Рабочая тетрадьquot; Пасечник, Калинова. Рабочая тетрадь издательства quot;Просвещениеquot; формата А-5, обложка — картон, листы — белые, скрепленные скрепкой, 80 страниц, шрифт — средний, черно-белые иллюстрации. Вы можете смотреть и читать гдз онлайн (без скачивания) с компьютера и мобильных устройств. Гдз решебник по биологии 5 класс рабочая тетрадь пасечник. Выберите номер задания тетради: Не нашел, что искал? Перейти к гдз рабочая тетрадь по биологии пасечник 5 класс. Рабочая тетрадь. К учебнику В.В. Пасечника quot;Биология. 5 класс, переработанному в соответствии с требованиями ФГОС и составляет с ним единый Учебно-Методический Комплект.. Пособия практичны, отвечают требованиям ФГОС к содержанию и оформлению. Здесь представлены ответы к рабочей тетради Биология 5 класс Пасечник. На reshebnikgdz.ru Вы можете скачать Решебник (ГДЗ) по истории 5 класс рабочая тетрадь Годер. Главная 5 класс Рабочая тетрадь по биологии для 5 класса (В.В. Пасечник) ГДЗ по окружающему миру. УМК В.В. Пасечник.Биология.5 класс.:учеб.для общеобразоват.учреждений-Москва.:Просвещение,2012. Скачать: рабочая программа по биологии 5 класс (фгос. пасечник в.в. линия жизни ).

Рисунки и данные анализа деформации формы показывают временную динамику гомеостатических и патогенных ответов на мутантный хантингтин

, специфичных для определенного типа клеток. Мы выполнили эти сравнения для генов, участвующих в молекулярных ответах, определенных на клеточном уровне (группа I) и более крупной группе (группа II), включающей объединение генов группы I и генов, которые модулируют выживание нейронов, но для которых клеточное назначение недоступно. (см. Материалы и методы).( A ) Перекрывается с генами, которые консервативны у Drosophila и которые модифицируют лазание у трансгенных мух с пан-нейрональной экспрессией видов Htt человека (Al-Ramahi et al., 2018). ( B ) Перекрывается с генами, которые консервативны в Caenorhabditis elegans и которые модифицируют реакцию на легкое прикосновение у трансгенных нематод с экспрессией N-концевого HTT человека в нейронах рецепторов прикосновения (Lejeune et al., 2012). Гены, перекрывающиеся с группой II, — это L3mbtl2 , Slc17a6 , Bche , Ugp2 , Col25a1 , Sdf4 , Mapk1 , Ccnebr1 0003000300030003000300030003000300030003000300030003000300030003000300030003000300030004 , Atp6v0a1 , Ip6k2 , Snw1 , Chtf18 , Pax6 , Pak3 , Pak1 , Ltbp4 , Snrpb Snw1 Lta4h , Tpo , Ybx1 , Cope , Alyref2 , Kbtbd4 , Plscr3 , Tbce , Nhp3 и , 9000 UCC3, и ( C ) Перекрывается с генами, которые консервативны у людей и которые связаны с модификацией возраста при моторном начале HD (p <10 -4 ) у участников GEM-HD (генетические модификаторы болезни Хантингтона (GeM -HD) Консорциум, 2019). ( D ) Перекрывается с генами, которые законсервированы у людей и которые не регулируются в хвостатом ядре пациентов с HD ( N = 2) по сравнению с контрольными участниками (Agus et al., 2019). ( E ) Перекрывается с установленными или предполагаемыми белковыми взаимодействующими элементами HTT, в данном случае с теми, которые идентифицированы с использованием библиотек человека, мыши и крысы (см. Ресурс HINT по адресу https: // chdifoundation.org / hdinhd /). Белковые взаимодействия HTT перекрываются с группой II: Aars , Abi2 , Actn1 , Actr2 , Adgrg1 , Akr7a5 , Alg2 , 0003 Apk2 b, Appl2 , Arpc5 , Ascc3 , Atp1b1, Atp6v0a1, Atp6v1b2, Bag1, Bin1, Cacna1b, Camk2a, Camk2g, Camsap3, Cbs, Cct4, Cct5, Cornask2, Clasp2, Cctamc1, Cctamc1, Clasp111 Dapk1, Dctn1, Dctn2, Ddost, Dhx37, Dhx40, Dnajc4, Dnm1l, Drd2, Eef2, Ehbp1, Eno3, Epb41, Erap1, Fahd2a, Fbl, Fhl2, Fis1, Flot2, Frm13, Grm1, Grm8, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm, Grm Hdlbp, Hsp90b1, Hspa2, Hspa8, Kars, Kif5c, Kpna2, Lyar, Mafg, Man1a2, Map1lc3a, Map3k10, Map6, Map7d1, Mapk1, Mbd4, Med14, Msh4, Myo1b, Nckap1, NDUFV, N1eddufh, N1eddufh, N1edduf, N1edduf Nolc1, Nos1, Numbl, Pabpc1, Pabpn1, Pacsin3, Pak1, Pard3, Pde4b, Pex11b, Pex5l, Picalm, Pip5k1c, Pop4, Ppil3, Ppp1ca, Ppp1r12c, Prdx2, Prkci4b, Rspc1 10a, Rps19, Rps6ka2, Rps6ka5, Rpsa, Satb1, Scarb2, Setdb1, Sfxn5, Slc17a6, Snd1, Snrpb, Snw1, Sod2, Sqstm1, Srrm1, Syp, Syt12, Taok1, Tcerg1, Tecrpm Uso1, Utp15, Vdac3, Vim, Vsnl1, Wdr12, Wrnip1, Ybx1, Zdbf2, и Zfp169 .

[PDF] Ресурсы по молекулярной биологии NCBI

Загрузить ресурсы по молекулярной биологии NCBI …

NCBI FieldGuide

Ресурсы по молекулярной биологии NCBI Полевое руководство

2-3 августа 2005 г.

Массачусетский университет

• Система NCBI Entrez • Базы данных последовательностей NCBI — Первичные данные: GenBank — Производные данные: RefSeq, Gene, Genome — Beyond Refseq: UniGene, Trace Archive

• Геномные ресурсы NCBI ** Intermission **

• BLAST • Структура и функция белка • Полиморфизмы и фенотипы последовательностей

NCBI FieldGuide

NCBI Resources

Bethesda, MD

Национальные институты здравоохранения

• Создан как часть NLM в 1988 году — — — —

Создание общедоступных баз данных Проведение исследований в области вычислительной биологии Разработка программных инструментов для анализа последовательностей Распространение биомедицинской информации

NCBI FieldGuide

Национальный центр биотехнологии Информация

Текст Entrez

Последовательность BLAST

Struct ure VAST

NCBI FieldGuide



NCBI FieldGuide

Пользователи веб-трафика NCBI в день Пользователи Интернета в мире


400000 Пользователи Интернета в США 300000







Рождество и Новый год


30 000 файлов в день 620 гигабайт в день

NCBI FieldGuide

Участок NCBI представление первичных данных • NCBI разрабатывает инструменты для анализа этих данных • NCBI использует эти инструменты для создания производных баз данных на основе первичных данных • NCBI обеспечивает бесплатный поиск, связывание и восстановление этих данных, в основном через систему Entrez

NCBI FieldGuide

Чем занимается NCBI?

• Первичные базы данных — Исходные материалы, представленные экспериментаторами — Контент контролируется отправителем • Примеры: GenBank, SNP, GEO, PubChem Substance

• Производные базы данных — Созданы на основе первичных данных — Контент контролируется третьей стороной (NCBI) • Примеры: Refseq , TPA, RefSNP, UniGene, Protein, Structure, Conserved Domain, PubChem Compound

NCBI FieldGuide

Типы баз данных


Центры секвенирования

GenBank Обновляется ТОЛЬКО заявителями INV VRT PHG11 VRL 9 GSS HTG


NCBI FieldGuide

Первичный vs.Производные базы данных

Постоянно обновляются NCBI

RefSeq: Конвейер аннотаций


Лаборатории кураторов

RefSeq: Конвейеры LocusLink и геномов TATAGCCG AGCTCCGATA • CCGAT9 • 911 • 911 • 911 • 911 • 911 • 911 • 911 • Связано базы данных Механизм текстового поиска Инструмент для поиска биологически связанных данных Механизм поиска Виртуальное рабочее пространство для работы с большими наборами данных

NCBI FieldGuide

Что такое Entrez?

NCBI FieldGuide

Система Entrez: поиск по тексту

• Каждой записи назначается UID — уникальный целочисленный идентификатор для внутреннего отслеживания — номер GI для нуклеотида

• Каждой записи дается сводка документа — сводка содержимого записи (DocSum)

• Каждой записи назначаются ссылки на биологически связанные UID • Каждая запись индексируется по полям данных — [автор], [название], [организм] и многие другие

NCBI FieldGuide

Базы данных Entrez

основа NCBI


NCBI FieldGuide

Таксономия Энтреса

• GenBank: первичные данные (97.9%) — оригинальные материалы, представленные экспериментаторами — отправители сохраняют редакционный контроль над записями — по своей природе архивные

• RefSeq: производные данные (2,1%) — курируются персоналом NCBI — NCBI сохраняет редакционный контроль над записями — содержание записей постоянно обновляется

NCBI FieldGuide

База данных Entrez — нуклеотид

Первичные данные • DDBJ / EMBL / GenBank 56 865 268 Производные данные

• RefSeq • PDB • Сторонние аннотации Всего

1,226 084 5,973 000u 4,650

02 такое GenBank?

• • • •

База данных только нуклеотидных последовательностей Архивная природа Каждой записи присваивается стабильный номер доступа. Данные GenBank — Прямая отправка (традиционные записи) — Пакетная отправка (EST, GSS, STS) — FTP-аккаунты (данные генома) • Три сотрудничающих базы данных — GenBank — База данных ДНК Японии (DDBJ) — База данных Европейской лаборатории молекулярной биологии (EMBL)

NCBI FieldGuide

База данных первичных последовательностей NCBI

NIH Sequin BankIt ftp

База данных NCBI FieldGuide

NCBI FieldGuide



• Представления • Обновления

• Представления • Обновления



DDBJ • Представления • Обновления




45 236 251 49 398 852 122> 140 000

Записи Нуклеотиды Виды

172 Гигабайт 901 19

785 файлов

• полный выпуск каждые два месяца • добавочные и накопительные обновления ежедневно • доступно только через Интернет ftp: // ftp.ncbi.nih.gov/genbank/

NCBI FieldGuide

Выпуски GenBank

NCBI FieldGuide

Рост GenBank


45 Basepairs Records

0002 35119 9000

0002 35119 9000


45,2 миллиона записей 49,4 миллиарда нуклеотидов


30 25

Среднее время удвоения ≈ 14 месяцев *


20 15



июн 04

июн 02

июн 00











июн 86


июн 86




Базовые пары (миллиарды)


40 записей (миллионы)




) (14) (13) (


(349) (120) (62) (6) (5)

Экспресс-последовательность Tag Genome Survey Sequence Высокая пропускная способность Геномная Высокая пропускная способность cDNA Sequence Tagged Site


NCBI FieldGuide

GenBank Divisions

• Прямая подача (Sequin / Bankit) • Точный (~ 1 ошибка на 10 000 п.н.) • Хорошо охарактеризован • Организован по таксономии

Массовый • Из проектов секвенирования • Пакетная отправка (ftp / электронная почта) • Неточна • Плохо охарактеризована • Организована по типу последовательности


AY182241 мРНК 1931 п.н., линейная PLN 04-МАЙ-2004 Malus x domestica (E, E) -альфа-фарнезенсинтаза (AFS1) мРНК, полные CD.ДОСТУП AY182241 ВЕРСИЯ AY182241.2 GI: 32265057 КЛЮЧЕВЫЕ СЛОВА. ИСТОЧНИК Malus x domestica (культурная яблоня) ОРГАНИЗМ Malus x domestica Eukaryota; Viridiplantae; Streptophyta; Эмбриофита; Tracheophyta; Сперматофиты; Magnoliophyta; эвдикотиледоны; основные эвдикоты; розиды; euroids I; Росалес; Розоцветные; Maloideae; Малус. ССЫЛКА 1 (с 1 по 1931 г.) АВТОРЫ Pechous, S.W. и Уитакер Б.Д. НАЗВАНИЕ Клонирование и функциональная экспрессия кДНК (E, E) -альфа-фарнезен-синтазы из кожуры плодов яблони JOURNAL Planta 219, 84-94 (2004) ССЫЛКА 2 (основания с 1 по 1931) АВТОРЫ Pechous, S.У. и Уитакер Б.Д. НАЗВАНИЕ Прямая подача ЖУРНАЛ подан (18 ноября 2002 г.) Лаборатория качества и безопасности PSI-Produce, USDA-ARS, 10300 Baltimore Ave. Bldg. 002, Ком. 205, Beltsville, MD 20705, США ССЫЛКА 3 (с 1 по 1931 г.) АВТОРЫ Pechous, S.W. и Уитакер Б.Д. НАЗВАНИЕ Прямая подача ЖУРНАЛ подан (25-ИЮН-2003) Лаборатория качества и безопасности PSI-Produce, USDA-ARS, 10300 Baltimore Ave. Bldg. 002, Ком. 205, Белтсвилль, Мэриленд 20705, США ПРИМЕЧАНИЕ Обновление последовательности отправителем КОММЕНТАРИЙ 26 июня 2003 г. эта версия последовательности заменила gi: 27804758.ОСОБЕННОСТИ Местоположение / Квалификаторы источник 1..1931 / организм = «Malus x domestica» / mol_type = «мРНК» / cultivar = «‘Law Rome'» / db_xref = «taxon: 3750» / fabric_type = «peel», ген 1 .. 1931 / gene = «AFS1» CDS 54..1784 / gene = «AFS1» / note = «терпен-синтаза» / codon_start = 1 / product = «(E, E) -альфа-фарнезен-синтаза» / protein_id = «AAO22848. 2» / db_xref = «GI: 32265058» / перевод = «MEFRVHLQADNEQKIFQNQMKPEPEASYLINQRRSANYKPNIWK NDFLDQSLISKYDGDEYRKLSEKLIEEVKIYISAETMDLVAKLELIDSVRKLGLANLF EKEIKEALDSIAAIESDNLGTRDDLYGTALHFKILRQHGYKVSQDIFGRFMDEKGTLE NHHFAHLKGMLELFEASNLGFEGEDILDEAKASLTLALRDSGHICYPDSNLSRDVVHS LELPSHRRVQWFDVKWQINAYEKDICRVNATLLELAKLNFNVVQAQLQKNLREASRWW ANLGIADNLKFARDRLVECFACAVGVAFEPEHSSFRICLTKVINLVLIIDDVYDIYGS EEELKHFTNAVDRWDSRETEQLPECMKMCFQVLYNTTCEIAREIEEENGWNQVLPQLT KVWADFCKALLVEAEWYNKSHIPTLEEYLRNGCISSSVSVLLVHSFFSITHEGTKEMA DFLHKNEDLLYNISLIVRLNNDLGTSAAEQERGDSPSSIVCYMREVNASEETARKNIK GMIDNAWKKVNGKCFTTNQVPFLSSFMNNATNMARVAHSLYKDGDGFGDQEKGPRTHI LSLLFQPLVN» ПРОИСХОЖДЕНИЯ 1 ttcttgtatc ccaaacatct cgagcttctt gtacaccaaa ttaggta TTC actatggaat 61 tcagagttca cttgcaagct gataatgagc agaaaatttt tcaaaaccag atgaaacccg 121 aacctgaagc ctcttacttg attaatcaaa gacggtctgc aaattacaag ccaaatattt 181 ggaagaacga tttcctagat caatctctta tcagcaaata cgatggagat gagtatcgga 241 agctgtctga gaagttaata gaagaagtta agatttatat atctgctgaa acaatggatt 1801 aataaatagc agcaaaagtt tgcggttcag ttcgtcatgg ataaattaat ctttacagtt 1861 tgtaacgttg ttgccaaaga ttatgaataa aaagttgtag tttgtcgttt аааааааааа 1921 AAAAAAAAAA а //

Заголовок формата плоского файла

Таблица функций


NCBI FieldGuide

Традиционная запись GenBank

Индексирование идентификатора нуклеотида 4680720

Поле [первичный доступ] [название] [дата модификации] [длина последовательности] [длина последовательности] [свойства]

Индексированные термины M17755 мРНК тироидной пероксидазы (TPO) Homo sapiens… Homo sapiens 3060 1999/04/26 biomol mrna gbdiv pri srcdb genbank

NCBI FieldGuide

An Example Record — M17755 NCBI FieldGuide

M17755: Таблица характеристик

TPO [название гена]

Положение CDS при тиреоидите [текстовое слово] тироидная пероксидаза [название белка] присоединение белка

Сама последовательность не индексируется … Используйте для этого BLAST!

NCBI FieldGuide

Последовательность: 99.Точность 99%

• • • • • • •

GenPept (DDBJ, EMBL, GenBank) RefSeq PIR Swiss Prot PDB PRF Аннотации третьих сторон


4,444,405 1,753,167 222395 189,005 68,621 12,69,991 NCID 4 Entrez Protein

PIR RefSeq

без мРНК!  NM_000537


без мРНК!

 M17755

NCBI FieldGuide

Источники белка и ссылки

Впервые в NCBI, а не в GenBank! Версия и GI изменяются только при изменении последовательности. Номер доступа всегда извлекает самую последнюю версию.

NCBI FieldGuide

Версии последовательности

NCBI FieldGuide

Обновление без изменения последовательности

15 июня 1989 года! GenBank пришел в NCBI в 1992 году!

NCBI FieldGuide

Обновление с изменением последовательности

ASN.1 — Плоский файл сырых данных

XML (4 вида)


NCBI FieldGuide

Форматы файлов GenBank

/ ******************* ************************************************ ***

* * asn2ff.c * преобразовать запись ASN.1 в формат плоского файла с помощью FFPrintArray. * ************************************************ ************************ / #include #include «asn2ff.h» #include «asn2ffp.h» #include «ffprint.h» # include #include #include #include #include

Источники панели инструментов

ftp> открыть ftp.ncbi.nih.gov. . #ifdef ENABLE_ID1 ftp> cd toolbox #include #endif ftp> cd ncbi_tools FILE * fpl;

Args myargs [] = {{«Имя файла для входа asn.1», «stdin», NULL, NULL, TRUE, ‘a’, ARG_FILE_IN, 0.0,0, NULL}, {«Входной элемент является Seq-записью» , «F», NULL, NULL, TRUE, ‘e’, ​​ARG_BOOLEAN, 0.0,0, NULL}, {«Ввод asnfile в двоичном режиме», «F», NULL, NULL, TRUE, ‘b’, ARG_BOOLEAN, 0,0 , 0, NULL}, {«Имя выходного файла», «stdout», NULL, NULL, TRUE, ‘o’, ARG_FILE_OUT, 0,0,0, NULL}, {«Показать последовательность?», «T», NULL, NULL, ИСТИНА, ‘h’, ARG_BOOLEAN, 0.0,0, NULL},


NCBI FieldGuide

NCBI Toolbox

term1 term2 Если не указан [предел]… Организм?  [организм] Журнал?  [журнал] Пользовательские соединения?  поиск по фразе Автор?  [автор] else [Все поля]

term1 [limit] OP term2 [limit] OP… где limit = поле индексации Entrez (организм, автор,…) op = AND, OR, NOT

NCBI FieldGuide

Текстовый поиск in Entrez


Предоставляет простую форму для применения часто используемых ограничений Entrez

Preview / Index

Позволяет получить доступ к полной индексации каждой базы данных Entrez и помогает в построении сложных запросов


Предоставляет доступ к предыдущим поискам в текущей базе данных Entrez

Буфер обмена

Область временного хранения для выбранных записей


Отображает подробный анализ текущего запроса Entrez и перечисляет ошибки и термины без совпадений

NCBI FieldGuide

Entrez Tabs

http : // www.ncbi.nih.gov/entrez/query/static/eutils_help.html

Entrez query


UID list or History

UID list or History


UID list or History

UID list or History

UID list or History

list или История


Список UID или История

Список UID



Сводные данные документа Форматированные данные

NCBI FieldGuide

Элемент программирования: E-Utilities

• Search Entrez.9% GenBank (первичные данные) — 2,1% RefSeq (курируемые данные) Возможные запросы, которые мы видели до сих пор… M17755 [первичный образец] тироидная пероксидаза [название] Homo sapiens [организм] 3060 [длина последовательности] биомол mrna [свойства] srcdb genbank [свойства]

TPO [название гена] тиреоидит [текстовое слово] тироидпероксидаза [название белка] 1999/04/26 [дата модификации] gbdiv pri [свойства]

NCBI FieldGuide

Поиск первичных последовательностей

Поиск записей нуклеотидов для пероксидазы щитовидной железы человека

Пероксидаза щитовидной железы человека

309 записей

((«Homo sapiens» [Организм] ИЛИ человек [Все поля]) И пероксидаза щитовидной железы [Все поля])

Предел поля! человек [организм] И щитовидная железа пероксидаза

298 записей

(«Homo sapiens» [Организм] И тироидная пероксидаза [Все поля])

11 записей не являются человеческими последовательностями !!

NCBI FieldGuide

A Начальный запрос

Нуклеотид Entrez GenBank RefSeq

srcdb ddbj / embl / genbank [свойства]

NCBI FieldGuide

Limit by Title и srcdb # 9000 базы данных 9000 9000 свойства 9000 9000 9000 9c119: свойства пероксидаза И человеческий [orgn] # 2: тироидная пероксидаза [название] И человеческий [orgn] # 3: # 2 И srcdb refseq [properties] # 4: # 2 И srcdb ddbj / embl / genbank [properties] первичные данные

298 169 5 164

EST Division Primate Division # 1: # 2: # 3: # 4:

NCBI FieldGuide

Ограничение, указанное подразделением Genbank gbdiv est [prop] gbdiv pri [prop]

тироидпероксидаза И человек [orgn] пероксидаза щитовидной железы [название] И человек [организация] # 2 И srcdb refseq [свойства] # 2 И srcdb ddbj / embl / genbank [properties]

# 5: # 4 И gbdiv est [prop] # 6: # 4 И gbdiv pri [prop]

20 144

традиционные записи GenBank

298 169 5 164

кДНК геномной ДНК # 1: # 2: # 3: # 4: # 5: # 6:

biomol genomic [prop] biomol mrna [prop]

тироид пероксидаза И человеческая [orgn] 298 тироидная пероксидаза [название] И человеческий [orgn] 169 # 2 И srcdb refseq [properties] 5 # 2 AND srcdb ddbj / embl / genbank [properties] 164 # 2 AND gbdiv est [prop] 20 # 2 AND gbdiv pri [prop] 144 геномной ДНК

# 7: # 6 AND biomol genomic [prop] # 8: # 6 И биомол мРНК [prop] мРНК / кДНК

26 118

NCBI FieldGuide

Ограничение по типу биомолекулы

тироидная пероксидаза [название белка] И человеческое [orgn] И gbdiv pri [prop] И биомол-мРНК [prop] 118 записей [название]  4 записи [имя белка]

NCBI FieldGuide

Ограничение по имени белка

Меню ссылок Щелкните ссылку для просмотра записи

Ссылки на другие базы данных Entrez, рассчитанные для M17755

NCBI FieldGuide

Краткое содержание документов Entrez

Аннотация гена на основе M17755 Полнотекстовые онлайн-статьи о M17755

Все po Лиморфизмы в генах TPO Последовательности ДНК / РНК, аналогичные M17755 Графическое изображение аннотации гена TPO Фенотипы человека с участием TPO

Наборы данных микроматрицы для M17755 Трансляция белка M17755 Отрывки из литературы о M17755 Полиморфизмы последовательностей в M17755

5 Исходный организм маркеров M17 Ген TPO Связи TPO за пределами NCBI

NCBI FieldGuide

Ссылки Entrez для GI 4680720

NCBI FieldGuide

Просмотр M17755

Какая из последовательностей является лучшей ???

NCBI FieldGuide

Последовательности GenBank для человеческого TPO

База данных производных последовательностей NCBI

Преимущества RefSeq • • • • • • •

NCBI FieldGuide


Обновленные нуклеотидные последовательности и несвязанные избыточные нуклеотидные последовательности:

текущие данные о последовательности и биология Подтверждены вручную Согласованность формата Четкая серия образцов Контроль со стороны сотрудников NCBI и сотрудников ftp: // ftp.ncbi.nih.gov/refseq/release

База данных производных последовательностей NCBI

• Курированные транскрипты и белки — NM_123456  NP_123456 — NR_123456 (некодирующая РНК) • Модельные транскрипты и белки — XM_123456 _123456 )

Нуклеотидный белок

• Собранные геномные области (контиги) — NT_123456 (клоны ВАС) — NW_123456 (WGS) • Другая геномная последовательность — NG_123456 (сложные области, псевдогены) — NZ_ABCD12345672 записи NZ_ABCD12345678 (WG9S_S_R) Геном Entrez — NC_123456 (хромосома; геном микробов или органелл)

NCBI FieldGuide


Аннотации генома

Самая длинная мРНК

NM должны иметь поддержку кДНК

NMs должны иметь поддержку кДНК

NCBI Records FieldG Records КОММЕНТАРИЙ ОБЗОР ОТЧЕТА: Эта запись была курирована персоналом NCBI.Эталонная последовательность была получена из M17755.2 и AW874082.1. 25 февраля 2003 г. эта версия последовательности заменила gi: 21361188.

NM_175719: вариант 2

EST, завершающий 3 ’конца

КОММЕНТАРИЙ ОБЗОР РЕФСЕК: Эта запись была курирована персоналом NCBI. Эталонная последовательность была получена из J02970.1, AW874082.1 и M17755.2.



NCBI FieldGuide

NM / NP Записи в Entrez

Геномная ДНК (NC, NT, NW)


Модель мРНК (XM) (XR)

Курированная мРНК (NM) (NR)

RefSeq Genbank Sequences

NCBI FieldGuide

Аннотирование гена

Модельный белок (XP)

=?! Curated Protein (NP)





• Entrez Gene является центральным хранилищем информации о гене, доступной в NCBI, и часто предоставляет ссылки на сайты за пределами NCBI

• Entrez Gene включает записи для организмов с эталонными последовательностями NCBI (RefSeqs) • Записи гена Entrez содержат мРНК RefSeq, белки и геномную ДНК (если известна) для локуса гена, а также ссылки на другие базы данных Entrez • RefSeq NCBI основаны на данных первичных последовательностей в GenBank

NCBI FieldGuide

Entrez Gene и RefSeq

NCBI FieldGuide

Entrez Gene: RefSeq Аннотации

NCBI FieldGuide

NM / NP Записи в Entrez Gene


9000Seq Gene



Entrez Gene

NCBI FieldGuide

Что насчет LOC440844?

Есть ли поддержка GenBank для этой мРНК? srcdb ddbj / embl / genbank [prop] AND biomol mrna [prop]

без полного совпадения

NCBI FieldGuide

Результаты BLAST для XM_496543

Записи XM являются моделями, основанными только на геномной последовательности, и могут быть пересмотрены или пересмотрены. удаление с каждой новой сборкой этого генома.ВЗРЫВАЙТЕ XM в базе данных RefSeq, чтобы найти замену: Query = gi | 20850420 | ref | XM_124429.1 | Mus musculus экспрессирует последовательность AA553001 (AA553001), мРНК gi | 19527087 | ref | NM_133873.1 | Сегмент ДНК Mus musculus, Chr 4, Государственный университет Уэйна 114, экспрессируется (D4Wsu114e), длина мРНК = 1898 Оценка = 3701,55 бит (1867), Expect = 0 Идентичность = 1870/1871 (99%), Gaps = 0/1871 (0 %) Strand = Plus / Plus

NCBI FieldGuide

Опасности XM

Bos taurus: 37541 Oryza sativa (группа сортов японская): 36836 Danio rerio: 30577 Homo musculus: 29261 Arabidopsis thaliana: 28 Rattus norvegicus: 23975 Pan troglodytes: 21810 Caenorhabditis elegans: 21124 Drosophila melanogaster: 19412 Aspergillus nidulans FGSC A4: 18951 Gallus gallus: 18120 Canisiliaris: 16891 Anopheles gambiae str.ВРЕДИТЕЛЬ: 15328 Plasmodium chabaudi: 14747 Candida albicans SC5314: 13672 Dictyostelium discoideum: 13570 Ustilago maydis 521: 13044 Plasmodium berghei: 11778 Gibberella zeae PH-1: 11640 Magnaportoe grisea histhoba 99: 11109 Neurospora HM-1: IMSS: 9772 Cryptococcus neoformans var. neoformans JEC21: 6594

NCBI FieldGuide

Eukaryotic NM / XM Records

Giardia lamblia ATCC 50803: 6569 Yarrowia lipolytica CLIB99: 6521 Debaryomyces hansenii CBS767: 6318 Apis 6218Cands mellifera: Schizosaccharomyces pombe 972h-: 5035 Eremothecium gossypii: 4718 Theileria parva: 4079 Xenopus tropicalis: 4069 Cryptosporidium hominis: 3886 Cryptosporidium parvum: 3396 Sus scrofa: 938 Trypanosoma brucei: 2599 yypoliscentus yavisi aries 105 Takifugu rubripes: 7 Ciona Кишечник: 3 Trypanosoma cruzi: 3

Компоненты GenBank (клоны, WGS)

NT / NW Contigs




NM / XM Master


NCBI FieldGuide

Аннотации генома в нуклеотиде Энтреза

курируемая мРНК 90 119

геномный контиг на хромосоме 2 человека, содержащий NM_000547

хромосома 2 человека

21 контиг сборки хромосомы 2

NCBI FieldGuide

Ссылки на аннотацию генома

Геномная последовательность

FieldGuide ПРИСОЕДИНЕНИЕ NC_000002 РЕГИОН: 1396242..1525502

ACCESSION NC_000002 REGION: 1396242..1525502

экзон-интронная структура

Эти плоские файлы содержат все аннотации в гене и полную явную последовательность

NCBI FieldGuide

Получение символа аннотации

: человеческая тироидная пероксидаза (ТПО) tpo [sym] И человеческий [организм]

NCBI FieldGuide

Searching Entrez Gene

Название белка: гены топоизомеразы из топоизомеразы архей [имя гена / белка] И архей [организм]

Хромосома и ссылки : гены на хромосоме 2 человека со связями 2 OMIM [хромосома] И ген omim [фильтр] И человек [организм]

Статус и варианты RefSeq: проверенные RefSeq с вариантами транскрипта srcdb refseq проверены [prop] И имеют варианты транскриптов [prop]

Болезнь и генная онтология: мембранные белки, связанные с раком, являющиеся неотъемлемой частью плазматической мембраны [генная онтология] И рак [дис]

Наборы данных микрочипов для ТПО

NCBI FieldGuide

Связи генов в Entrez

Гомологи генов для ДНК ТПО и последовательностей РНК для фенотипов ТРО, включающих ТПО Белковые последовательности для ТРО Отрывки из литературы о полиморфизмах последовательностей ТРО у видов ТРО, в геноме которых есть этот ген ТПО, маркеры STS в гене ТРО EST, выровненные с геном TPO

NCBI теперь принимает представление новых аннотаций существующих последовательностей GenBank.

NCBI FieldGuide

База данных сторонних аннотаций (TPA) • Материалы должны быть опубликованы в рецензируемом журнале. • Облегчает аннотирование последовательностей экспертами. Примерами последовательностей, подходящих для TPA, являются: Аннотация особенностей последовательностей генов и / или мРНК Собранные «полноразмерные» гены и / или мРНК Что не следует отправлять в TPA?

Синтетические конструкции (например, клонирующие векторы), в которых используются хорошо охарактеризованные общедоступные гены, промоторы или терминаторы

Обновления или изменения существующих данных о последовательностях Аннотации последовательностей без экспериментальных данных

Если в вашем организме нет RefSeqs… • UniGene : генные кластеры кДНК и EST

• Последовательности WGS в нуклеотиде Entrez (wgs [prop]) • Архив трассировки

NCBI FieldGuide

Beyond RefSeq

Генно-ориентированное представление записей последовательностей • Автоматическая кластеризация последовательностей на основе MegaBlast • Теперь информация о геномных хитах Новинка! • Неизбыточный набор ориентированных на гены кластеров • Каждый кластер — уникальный ген • Информация о типах тканей и расположении на карте • Включает известные гены и не охарактеризованные EST • Полезно для обнаружения генов и выбора реагентов для картирования

NCBI FieldGuide

Что такое UniGene?

Первая десятка 1.Человек 2. Рис 3. Мышь 4. Корова 5. Пшеница 6. Данио 7. Свинья 8. Курица 9. Лягушка (X. laevis) 10. Лягушка (X. tropicalis)

NCBI FieldGuide

Организмы в UniGene

by ссылка

по поиску Entrez

NCBI FieldGuide

Поиск кластеров UniGene

NCBI FieldGuide

UniGene Cluster для TPO

Описание платформы GPL


GSE Обработка данных на кристалле / слайды


GSE Group один слайд / чип «единый эксперимент»

Entrez GEO

Куратор NCBI

NCBI FieldGuide

Представлено производителем *

Представлено экспериментаторами

GDS Группировка экспериментов

Entrez GEO 9Guide

Связь с GEO

NCBI FieldGuide

Наборы данных GEO

• Традиционные подразделения GenBank • Более 300 проектов — — — — —

Вирусы Ba cteria Экологические последовательности Archaea 73 Эукариоты, включающие: • • • • • •

Корова, Курица, Крыса, Мышь, Собака, Шимпанзе, Человек-иглобрюх (2), Медоносная пчела данио, Anopheles, Плодовые мухи (4), Нематода тутового шелкопряда (C.briggsae) Дрожжи (9), Aspergillus (3) Рис

NCBI FieldGuide

Проекты дробовика полного генома

NCBI FieldGuide

Архив трассировки

NCBI FieldGuide


• Предоставляются полные хромосомные последовательности

• Гены аннотируются • Аннотации могут отображаться графически и связываться с записями последовательностей

NCBI FieldGuide

Просмотр простых геномов

NCBI FieldGuide



Map Viewer • Домашняя страница Map Viewer — Отображает все поддерживаемые организмы — Предоставляет ссылки на геномный BLAST

• Обзорную страницу генома — Предоставляет ссылки на отдельные хромосомы — Отображает совпадения в геноме графически

• Страница просмотра хромосом — Позволяет интерактивный просмотр деталей аннотации — Предоставляет множество карт, уникальных для каждого генома

NCBI FieldGuide 9 0119

Просмотр сложных геномов

NCBI FieldGuide

Домашняя страница Map Viewer

Поиск на картах

Genomic BLAST

Помощь по видам!

NCBI FieldGuide

Страница обзора генома

Обзор карты Добавление или удаление карт Основная карта с разнесенным содержимым

Genes UniGene Contigs Элементы управления масштабированием


NCBI FieldGuide

Chromosome Просмотр страницы


NCBI FieldGuide

Сводка карты

Содержание карты сильно различается в зависимости от вида!

• Карты последовательностей • Сборка ядра • Свидетельства аннотации • Клоны и маркеры • Полиморфизмы • Ссылки и особенности

• Генетические карты • Цитогенетические карты • Карты связей • Радиационные гибридные карты

Сборка компонента Contig Component Transcript Gene

NCBI FieldGuide

Карта Содержание

NCBI FieldGuide

Просмотр сборки рядом с TPO

NT_033000 1255072 1563756

NCBI FieldGuide

Сборка Chr.2

NCBI FieldGuide

Сборка хромосомы 2

NCBI FieldGuide


NCBI FieldGuide


Ссылки на Entrez Nucleotide

Ссылки на сборку данных Entrez

Ссылки на инструменты для сборки Entrez


Содержание карты сильно различается в зависимости от вида!

• Карты последовательностей • Сборка ядра • Свидетельства аннотации • Клоны и маркеры • Полиморфизмы • Ссылки и особенности

• Генетические карты • Цитогенетические карты • Карты связей • Радиационные гибридные карты

Ab initio (модель) GenBank DNA EST UniGene Gene

NCBI FieldGuide

Содержимое карты

Записи GenBank не используются в сборке Согласованные EST

NCBI FieldGuide

Свидетельства аннотации

UniGene Clusters Ab initio модели

Гомологи по белку BLAST

9G002 NCBI Mo0002 Ресурсы
 NCBI FieldGuide
NCBI Молекулярная биология
Полевое руководство
2-3 августа 2005 г.
Массачусетский университет
• Система NCBI Entrez
• Базы данных последовательностей NCBI
- Первичные данные: GenBank
- Производные данные: RefSeq, Gene, Genome
- Помимо Refseq: UniGene, Trace Archive
• Геномные ресурсы NCBI
** антракт **
• Структура и функции белка
• Полиморфизмы и фенотипы последовательностей
NCBI FieldGuide
Ресурсы NCBI
Бетесда, Мэриленд
NCBI FieldGuide
Национальные институты здоровья
• Создан как часть NLM в 1988 г.
Создание общедоступных баз данных
Провести исследования в области вычислительной биологии
Разработка программных инструментов для анализа последовательностей
Распространять биомедицинскую информацию
NCBI FieldGuide
Национальный центр
Информация о биотехнологии
NCBI FieldGuide
600 000
NCBI FieldGuide
NCBI веб-трафик
Пользователя в день
500 000
400 000
300 000
200 000
100 000
1998 г.
1999 г.
2000 г.
2001 г.
2002 г.
2003 г.
2004 г.
Рождество и Новый год
2005 г.
30 000 файлов в день
620 Гигабайт в сутки
NCBI FieldGuide
Ftp-сайт NCBI
• NCBI принимает первичные данные
• NCBI разрабатывает инструменты для анализа этих данных.
• NCBI использует эти инструменты для создания производных финансовых инструментов.
базы данных на основе первичных данных
• NCBI предоставляет бесплатный поиск, ссылки и
восстановление этих данных, в первую очередь через
система Entrez
NCBI FieldGuide
Чем занимается NCBI?
• Первичные базы данных
- Оригинальные материалы, представленные экспериментаторами
- Контент, контролируемый отправителем
• Примеры: GenBank, SNP, GEO, PubChem Substance.
• Производные базы данных
- Построен из первичных данных
- Контент, контролируемый третьей стороной (NCBI)
• Примеры: Refseq, TPA, RefSNP, UniGene, Protein, Structure,
Консервированный домен, соединение PubChem
NCBI FieldGuide
Типы баз данных
Последовательность действий
ТОЛЬКО обновлено
стандартное восточное время
NCBI FieldGuide
Первичный vs.Производные базы данных
LocusLink и
Геномы трубопроводов
Система из 29 связанных баз данных
Система текстового поиска
Инструмент для поиска биологически связанных данных
Поисковая машина
Виртуальное рабочее пространство для управления большими
наборы данных
NCBI FieldGuide
Что такое Энтрес?
NCBI FieldGuide
Система Entrez: поиск по тексту
• Каждой записи присваивается UID
- уникальный целочисленный идентификатор для внутреннего отслеживания
- Номер GI для нуклеотида
• Каждой записи дается краткое изложение документа.
- краткое изложение содержания записи (DocSum)
• Каждой записи присваиваются ссылки на биологически
связанные UID
• Каждая запись индексируется по полям данных
- [автор], [название], [организм] и многие другие
NCBI FieldGuide
Базы данных Entrez
Основа NCBI
NCBI FieldGuide
Таксономия Энтреса
• GenBank: первичные данные (97.9%)
- оригинальные материалы, представленные экспериментаторами
- отправители сохраняют редакционный контроль над записями
- архивный характер
• RefSeq: производные данные (2,1%)
- кураторский состав NCBI
- NCBI сохраняет редакционный контроль над записями
- содержание записи постоянно обновляется
NCBI FieldGuide
База данных Entrez - нуклеотид
Первичные данные
• DDBJ / EMBL / GenBank 56 865 268
Производные данные
• RefSeq
• Сторонние аннотации
5 973
58 101 975
NCBI FieldGuide
Энтрез Нуклеотид
Что такое GenBank?
База данных последовательностей только нуклеотидов
Архив на природе
Каждой записи присваивается стабильный инвентарный номер.
Данные GenBank
- Прямая подача (традиционные записи)
- Пакетные представления (EST, GSS, STS)
- ftp-аккаунты (данные генома)
• Три взаимодействующие базы данных
- ГенБанк
- База данных ДНК Японии (DDBJ)
- Европейская лаборатория молекулярной биологии (EMBL)
База данных
NCBI FieldGuide
База данных первичных последовательностей NCBI
Национальные институты здравоохранения США
NCBI FieldGuide
Международная последовательность
Совместная работа с базами данных
• Материалы
• Обновления
• Материалы
• Обновления
• Материалы
• Обновления
Выпуск 148
Июнь 2005 г.
45 236 251
49 398 852 122
> 140 000
172 Гигабайт
785 файлов
• полный выпуск каждые два месяца
• ежедневные инкрементные и накопительные обновления
• доступно только через Интернет
ftp: // ftp.ncbi.nih.gov/genbank/
NCBI FieldGuide
Релизы GenBank
NCBI FieldGuide
Рост GenBank
Пар оснований
Выпуск 148:
35 год
35 год
45,2 миллиона записей
49,4 миллиарда нуклеотидов
Среднее время удвоения ≈ 14 месяцев *
Базовые пары (миллиарды)
Рекорды (в миллионах)
Растение и грибок
Бактериальный / Археальный
Другое позвоночное
Без аннотации
стандартное восточное время
Выраженный тег последовательности
Последовательность исследования генома
Геномный с высокой пропускной способностью
КДНК с высокой пропускной способностью
Последовательность помеченных сайтов
NCBI FieldGuide
Подразделения GenBank
• Прямая подача (Sequin / Bankit)
• Точность (~ 1 ошибка на 10 000 б.п.)
• Хорошо охарактеризован
• Организовано по таксономии
• Из проектов секвенирования
• Пакетная отправка (ftp / электронная почта)
• Неточно
• Плохо охарактеризован
• Организовано по типу последовательности
1931 г.
04 МАЯ 2004 ГОДА
МРНК Malus x domestica (E, E) -альфа-фарнезен-синтазы (AFS1),
полные компакт-диски.ПРИСОЕДИНЕНИЕ
AY182241.2 GI: 32265057
Malus x domestica (культурное яблоко)
ОРГАНИЗМ Malus x domestica
Эукариоты; Viridiplantae; Streptophyta; Эмбриофита; Tracheophyta;
Сперматофиты; Magnoliophyta; эвдикотиледоны; основные эвдикоты;
розиды; euroids I; Росалес; Розоцветные; Maloideae; Малус.
1 (с 1 по 1931 г.)
Печоус, С. и Уитакер Б.Д.
Клонирование и функциональная экспрессия (E, E) -альфа-фарнезена
кДНК синтазы из кожуры плодов яблони
Планта 219, 84-94 (2004)
2 (с 1 по 1931 г.)
Печоус, С.У. и Уитакер Б.Д.
Прямая подача
Отправлено (18 ноября 2002 г.) Лаборатория качества и безопасности PSI-Produce,
USDA-ARS, 10300 Baltimore Ave. Bldg. 002, Ком. 205, Белтсвилл, Мэриленд
20705, США
3 (с 1 по 1931 г.)
Печоус, С. и Уитакер Б.Д.
Прямая подача
Отправлено (25 июня 2003 г.) Лаборатория качества и безопасности PSI-Produce,
USDA-ARS, 10300 Baltimore Ave. Bldg. 002, Ком. 205, Белтсвилл, Мэриленд
20705, США
Обновление последовательности отправителем
26 июня 2003 г. эта версия последовательности заменила gi: 27804758.ОСОБЕННОСТИ
Расположение / квалификаторы
/ организм = "Malus x domestica"
/ mol_type = "мРНК"
/ cultivar = "'Рим закона'"
/ db_xref = "таксон: 3750"
/ fabric_type = "кожура"
/ gene = "AFS1"
/ gene = "AFS1"
/ note = "терпен-синтаза"
/ codon_start = 1
/ product = "(E, E) -альфа-фарнезенсинтаза"
/protein_id="AAO22848.2 "
/ db_xref = "GI: 32265058"
1 ttcttgtatc ccaaacatct cgagcttctt gtacaccaaa ttaggtattc actatggaat
61 tcagagttca cttgcaagct gataatgagc agaaaatttt tcaaaaccag atgaaacccg
121 aacctgaagc ctcttacttg attaatcaaa gacggtctgc aaattacaag ccaaatattt
181 ggaagaacga tttcctagat caatctctta tcagcaaata cgatggagat gagtatcgga
241 agctgtctga gaagttaata gaagaagtta agatttatat atctgctgaa acaatggatt
1801 aataaatagc agcaaaagtt tgcggttcag ttcgtcatgg ataaattaat ctttacagtt
1861 tgtaacgttg ttgccaaaga ttatgaataa aaagttgtag tttgtcgttt aaaaaaaaaa
1921 ааааааааа а
Формат плоских файлов
Таблица характеристик
NCBI FieldGuide
Традиционный рекорд GenBank
Индексирование для UID нуклеотида 4680720
[первичное присоединение]
[длина последовательности]
[дата изменения]
Проиндексированные термины
МРНК тироидной пероксидазы (ТПО) человека…
Homo sapiens
биомол мрнн
gbdiv pri
srcdb genbank
NCBI FieldGuide
Пример записи - M17755
NCBI FieldGuide
M17755: Таблица характеристик
TPO [название гена]
Позиция CDS в б.п.
[текстовое слово]
пероксидаза щитовидной железы
[название белка]
Сама последовательность
не индексируется…
Используйте для этого BLAST!
NCBI FieldGuide
Последовательность: 99.99% точность
GenPept (DDBJ, EMBL, GenBank)
Швейцарский Prot
Аннотации третьих сторон
4 444 405
222 395
189 005
68 621
12 079
4 219
6 693 891
NCBI FieldGuide
Энтрез Протеин
нет мРНК!
 NM_000537
нет мРНК!
 M17755
NCBI FieldGuide
Источники белка и ссылки
Впервые замечен в NCBI, а не
впервые увидел в GenBank!
Версия и GI меняются только при изменении последовательности
Номер доступа всегда извлекает самую последнюю версию.
NCBI FieldGuide
Изменения последовательности
NCBI FieldGuide
Обновление без изменения последовательности
15 июня 1989 года!
GenBank пришел
в NCBI в 1992 году!
NCBI FieldGuide
Обновление с изменением последовательности
ASN.1 - Необработанные данные
плоский файл
XML (4 разновидности)
NCBI FieldGuide
Форматы файлов GenBank
/ *********************************************** ***********************
преобразовать запись ASN.1 в формат плоского файла с помощью FFPrintArray.
************************************************ ************************ /
#include "asn2ff.h"
#include "asn2ffp.h"
#include "ffprint.h"
# включить 
Источники Toolbox
ftp> откройте ftp.ncbi.nih.gov
#ifdef ENABLE_ID1
ftp> набор инструментов для компакт-диска
ftp> cd ncbi_tools
FILE * fpl;
Args myargs [] = {
{"Имя файла для входа asn.1", "stdin", NULL, NULL, TRUE, 'a', ARG_FILE_IN, 0.0,0, NULL},
{"Ввод является последовательной записью", "F", NULL, NULL, TRUE, 'e', ​​ARG_BOOLEAN, 0.0,0, NULL},
{"Входной файл asnfile в двоичном режиме", "F", NULL, NULL, TRUE, 'b', ARG_BOOLEAN, 0.0,0, NULL},
{"Имя выходного файла", "stdout", NULL, NULL, TRUE, 'o', ARG_FILE_OUT, 0.0,0, NULL},
{"Показать последовательность?", "T", NULL, NULL, TRUE, 'h', ARG_BOOLEAN, 0.0,0, NULL},
NCBI FieldGuide
NCBI Toolbox
термин1 термин2
Если [предел] не указан…
Организм?  [организм]
Журнал?  [журнал]
Пользовательские соединения?  поиск по фразе
Автор?  [автор]
else [Все поля]
term1 [предел] OP term2 [предел] OP…
limit = Поле индексации Entrez (организм, автор,…)
op = И, ИЛИ, НЕ
NCBI FieldGuide
Текстовые поиски в Entrez
Предоставляет простую форму для применения часто используемых пределов Энтреса.
Предварительный просмотр / индекс
Предоставляет доступ к полной индексации каждой базы данных Entrez
и помогает в построении сложных запросов
Предоставляет доступ к предыдущим поискам в текущей базе данных Entrez
Буфер обмена
Область временного хранения выбранных записей
Отображает подробный анализ текущего запроса Entrez, и
перечисляет ошибки и термины без совпадений
NCBI FieldGuide
Вкладки Entrez
http: // www.ncbi.nih.gov/entrez/query/static/eutils_help.html
Запрос Entrez
Список UID или история
Список UID или история
Список UID или история
Список UID или история
Список UID или история
Список UID
Резюме документов
Отформатированные данные
NCBI FieldGuide
Entrez программирования: E-Utilities
• Поиск нуклеотидов Entrez
- 97,9% GenBank (первичные данные)
- 2,1% RefSeq (тщательно отобранные данные)
Возможные запросы, которые мы уже видели…
M17755 [первичный регистр]
пероксидаза щитовидной железы [название]
Homo sapiens [организм]
3060 [длина последовательности]
biomol mrna [свойства]
srcdb genbank [свойства]
TPO [название гена]
тиреоидит [текстовое слово]
пероксидаза щитовидной железы [название белка]
1999/04/26 [дата изменения]
gbdiv pri [свойства]
NCBI FieldGuide
Поиск первичных последовательностей
Найдите записи нуклеотидов для пероксидазы щитовидной железы человека
пероксидаза щитовидной железы человека
309 записей
((«Homo sapiens» [Организм] ИЛИ человек [Все поля]) И
пероксидаза щитовидной железы [Все поля])
Предел поля!
человеческий [организм] И пероксидаза щитовидной железы
298 записей
("Homo sapiens" [Организм] И пероксидаза щитовидной железы [Все поля])
11 записей не являются человеческими последовательностями !!
NCBI FieldGuide
Начальный запрос
Энтрез Нуклеотид
srcdb ddbj / embl / genbank [свойства]
NCBI FieldGuide
Ограничение по заголовку и базе данных
srcdb refseq [свойства]
№1: пероксидаза щитовидной железы И человек [orgn]
№2: пероксидаза щитовидной железы [название] И человек [организация]
# 3: # 2 И srcdb refseq [свойства]
# 4: # 2 И srcdb ddbj / embl / genbank [свойства]
первичные данные
Дивизион EST
Подразделение приматов
# 2:
# 3:
# 4:
NCBI FieldGuide
Лимит подразделения Genbank
gbdiv est [опора]
gbdiv pri [опора]
пероксидаза щитовидной железы И человек [orgn]
пероксидаза щитовидной железы [название] И человек [организация]
# 2 И srcdb refseq [свойства]
# 2 И srcdb ddbj / embl / genbank [свойства]
# 5: # 4 И gbdiv est [опора]
# 6: # 4 И gbdiv pri [prop]
традиционные отчеты GenBank
Геномная ДНК
# 2:
# 3:
# 4:
# 5:
# 6:
биомол геномный [опора]
биомол мрнн [опора]
пероксидаза щитовидной железы И человек [orgn]
пероксидаза щитовидной железы [название] И человек [организация]
# 2 И srcdb refseq [свойства]
# 2 И srcdb ddbj / embl / genbank [свойства] 164
# 2 И gbdiv est [опора]
# 2 И gbdiv pri [опора]
геномная ДНК
# 7: # 6 И биомол, геномный [опора]
# 8: # 6 И биомол mrna [prop]
26 год
NCBI FieldGuide
Ограничение по типу биомолекулы
пероксидаза щитовидной железы [название белка] И человек [организация] И
gbdiv pri [опора] И биомол mrna [опора]
118 записей [название]  4 записи [название белка]
NCBI FieldGuide
Ограничение по названию белка
Меню ссылок
Щелкните ссылку, чтобы просмотреть запись
Ссылки на другие
Базы данных Entrez
вычислено для
NCBI FieldGuide
Краткое содержание документа Entrez
Аннотации гена на основе M17755
Полнотекстовые онлайн-статьи о M17755
Все полиморфизмы в гене TPO
Последовательности ДНК / РНК, подобные M17755
Графическое изображение аннотации гена TPO
Фенотипы человека с участием ТПО
Наборы данных микрочипов для M17755
Белковая трансляция M17755
Рефераты по M17755
Полиморфизмы последовательностей в M17755
Исходный организм M17755
Маркеры STS в гене TPO
Связи TPO за пределами NCBI
NCBI FieldGuide
Ссылки Entrez для GI 4680720
NCBI FieldGuide
Просмотр M17755
Какая из них лучшая ???
NCBI FieldGuide
Последовательности GenBank для ТРО человека
База данных производных последовательностей NCBI
Преимущества RefSeq
NCBI FieldGuide
Явно связанные нуклеотидные и белковые последовательности
Обновлено для отражения текущих данных о последовательности и биологии
Подтверждено вручную
Согласованность формата
Отличная серия присоединения
Управление со стороны сотрудников и сотрудников NCBI
ftp: // ftp.ncbi.nih.gov/refseq/release
База данных производных последовательностей NCBI
• Курируемые транскрипты и белки
- NM_123456  NP_123456
- NR_123456 (некодирующая РНК)
• Моделируйте транскрипты и белки.
- XM_123456  XP_123456
- XR_123456 (некодирующая РНК)
• Собранные геномные области (контиги)
- NT_123456 (клоны BAC)
- NW_123456 (WGS)
• Другая геномная последовательность
- NG_123456 (сложные области, псевдогены)
- NZ_ABCD12345678 (WGS)  ZP_123456
• Хромосомные записи в Entrez Genome
- NC_123456 (хромосома; геном микробов или органелл)
NCBI FieldGuide
Аннотации генома
Самая длинная мРНК
НМ должны иметь
поддержка кДНК
NCBI FieldGuide
Создание записей NM
NM_000547: вариант 1
КОММЕНТАРИЙ ОБЗОР ОТЧЕТА: Эта запись была курирована персоналом NCBI.Эталонная последовательность была получена из M17755.2 и AW874082.1.
25 февраля 2003 г. эта версия последовательности заменила gi: 21361188.
NM_175719: вариант 2
EST, завершающий 3 ’конца
КОММЕНТАРИЙ ОБЗОР ОТЧЕТА: Эта запись была курирована персоналом NCBI.
Эталонная последовательность была получена из J02970.1, AW874082.1 и M17755.2.
NCBI FieldGuide
Записи NM / NP в Энтресе
Геномная ДНК
(Северная Каролина, Северная Каролина, Северо-Запад)
Сканирование ....
Модель мРНК (XM)
Курированная мРНК (NM)
NCBI FieldGuide
Аннотирование гена
Модельный белок (XP)
знак равно
Курированный протеин (NP)
• Entrez Gene - это центральное хранилище информации о генах.
доступны в NCBI и часто содержат ссылки на сайты за пределами NCBI.
• Entrez Gene включает записи для организмов, имеющих ссылку NCBI.
Последовательности (RefSeqs)
• Записи Entrez Gene содержат мРНК RefSeq, белки и геномные
ДНК (если известно) локуса гена, а также ссылки на другие базы данных Entrez
• NCBI RefSeqs основаны на данных первичной последовательности в GenBank
NCBI FieldGuide
Энтрез Джин и RefSeq
NCBI FieldGuide
Энтрез Джин: Аннотации RefSeq
NCBI FieldGuide
Записи NM / NP в Entrez Gene
NCBI FieldGuide
Entrez Gene RefSeq Графика
Энтрес Джин
NCBI FieldGuide
А как насчет LOC440844?
Есть ли поддержка этой мРНК GenBank?
srcdb ddbj / embl / genbank [prop] AND biomol mrna [prop]
нет полнометражного хита
NCBI FieldGuide
Результаты BLAST для XM_496543
Записи XM представляют собой модели, основанные только на геномной последовательности, и подлежат
на пересмотр или удаление с каждой новой сборкой этого генома.ВЗРЫВАЙТЕ XM в базе данных RefSeq, чтобы найти замену:
Query = gi | 20850420 | ref | XM_124429.1 |
Mus musculus экспрессирует последовательность AA553001 (AA553001), мРНК
gi | 19527087 | ссылка | NM_133873.1 |
Сегмент ДНК Mus musculus, Chr 4, Государственный университет Уэйна 114,
экспрессируется (D4Wsu114e), длина мРНК = 1898
Оценка = 3701,55 бит (1867), ожидание = 0
Идентичности = 1870/1871 (99%), Пробелы = 0/1871 (0%) Strand = Плюс / Плюс
NCBI FieldGuide
Опасности XM
Bos taurus:
Oryza sativa (группа сортов японская):
Данио рерио:
Homo sapiens:
Arabidopsis thaliana:
Mus musculus:
Rattus norvegicus:
Пан троглодиты:
Caenorhabditis elegans:
Drosophila melanogaster:
Aspergillus nidulans FGSC A4:
Gallus gallus:
Породы обыкновенные:
Anopheles gambiae str.ВРЕДИТЕЛЬ:
Plasmodium chabaudi:
Candida albicans SC5314:
Dictyostelium discoideum:
Ustilago maydis 521:
Plasmodium berghei:
Gibberella zeae PH-1:
Magnaporthe grisea 70-15:
Neurospora crassa:
Aspergillus fumigatus Af293:
Entamoeba histolytica HM-1: IMSS:
Cryptococcus neoformans var. neoformans JEC21: 6594
NCBI FieldGuide
Эукариотические записи NM / XM
Giardia lamblia ATCC 50803:
Yarrowia lipolytica CLIB99:
Debaryomyces hansenii CBS767:
Apis mellifera:
Kluyveromyces lactis NRRL Y-1140: 5327
Candida glabrata CBS138:
Schizosaccharomyces pombe 972h-: 5035
Eremothecium gossypii:
Theileria parva:
Xenopus tropicalis:
Cryptosporidium hominis:
Cryptosporidium parvum:
Sus scrofa:
Trypanosoma brucei:
Овис Овен:
Strongylocentrotus purpuratus:
Felis catus:
Плазмодий yoelii yoelii:
Такифугу рубрипс:
Циона кишечника:
Trypanosoma cruzi:
Компоненты GenBank
(клоны, WGS)
Контиги NT / NW
Составные части
Составные части
NCBI FieldGuide
Аннотации генома в нуклеотиде Энтреза
курированная мРНК
геномный контиг на хромосоме 2 человека
содержащий NM_000547
хромосома 2 человека
21 контиг
сборка хромосомы 2
NCBI FieldGuide
Ссылки на аннотации генома
Геномная последовательность
NCBI FieldGuide
Получение сведений об аннотации
ПРИСОЕДИНЕНИЕ NC_000002 РЕГИОН: 1396242..1525502
ПРИСОЕДИНЕНИЕ NC_000002 РЕГИОН: 1396242..1525502
экзон-интронная структура
Эти плоские файлы содержат все аннотации в гене и полную явную последовательность
NCBI FieldGuide
Получение сведений об аннотации
Символ гена: пероксидаза щитовидной железы человека (ТПО)
tpo [сим] И человек [организм]
NCBI FieldGuide
В поисках Энтреза Джина
Название белка: гены топоизомеразы из архей
топоизомераза [название гена / белка] И археи [организм]
Хромосома и связи: гены на хромосоме 2 человека со связями OMIM
2 [хромосома] И ген omim [фильтр] И человек [организм]
Статус и варианты RefSeq: просмотренные RefSeq с вариантами расшифровки
srcdb refseq проверен [prop] И имеет варианты расшифровки [prop]
Онтология болезней и генов: мембранные белки, связанные с раком
неотъемлемая часть плазматической мембраны [генная онтология] И рак [дис]
Наборы данных микрочипов для TPO
NCBI FieldGuide
Джин Ссылки в Entrez
Гомологи генов ТПО
Последовательности ДНК и РНК для ТПО
Фенотипы с участием ТПО
Последовательности белков для ТПО
Литературные аннотации по TPO
Полиморфизмы последовательностей в TPO
Виды, в геноме которых присутствует этот ген TPO
Маркеры STS в гене TPO
EST, согласованные с геном TPO
NCBI теперь принимает подачу новых аннотаций
существующих последовательностей GenBank.NCBI FieldGuide
Аннотации третьих сторон
(TPA) База данных
• Материалы должны быть опубликованы в рецензируемом журнале.
• Облегчает аннотирование последовательностей экспертами.
Примеры последовательностей, подходящих для TPA:
Аннотации особенностей последовательностей генов и / или мРНК
Собранные «полноразмерные» гены и / или мРНК
Что нельзя подавать в TPA?
Синтетические конструкции (такие как векторы клонирования), в которых используются хорошо охарактеризованные,
общедоступные гены, промоторы или терминаторы
Обновления или изменения существующих данных последовательности
Аннотации последовательностей без экспериментальных доказательств
Если в вашем организме нет RefSeqs…
• UniGene: генные кластеры кДНК и EST
• Последовательности WGS в нуклеотиде Entrez (wgs [prop])
• Архив трассировки
NCBI FieldGuide
За пределами RefSeq
Генно-ориентированный взгляд на записи последовательностей
• Автоматическая кластеризация последовательностей на основе MegaBlast
• Теперь информация о геномных хитах Новинка!
• Неизбыточный набор генно-ориентированных кластеров
• Каждый кластер - уникальный ген
• Информация о типах тканей и местоположениях на карте
• Включает известные гены и не охарактеризованные EST.
• Полезно для открытия генов и выбора
картографические реагенты
NCBI FieldGuide
Что такое UniGene?
Десятка лидеров
2. Рис
3. Мышь
4. Корова
5. Пшеница
6. Данио
7. Свинья
8. Курица
9. Лягушка (X. laevis)
10. Лягушка (X. tropicalis)
NCBI FieldGuide
Организмы в UniGene
по ссылке
по поиску Entrez
NCBI FieldGuide
Поиск кластеров UniGene
NCBI FieldGuide
UniGene Cluster для TPO
Сырые / обработанные
данные слайда / чипа
интенсивность пятна
из одного «единственного эксперимента»
слайд / чип
Entrez GEO
NCBI FieldGuide
Производитель *
Наборы данных GEO
NCBI FieldGuide
Ссылка на GEO
NCBI FieldGuide
Наборы данных GEO
• Традиционные подразделения GenBank
• 300+ проектов
Последовательности окружающей среды
73 эукариот с:
Корова, Курица, Крыса, Мышь, Собака, Шимпанзе, Человека
Иглобрюх (2), Данио
Медоносная пчела, анофелес, плодовые мухи (4), шелкопряд
Нематода (C.briggsae)
Дрожжи (9), Aspergillus (3)
NCBI FieldGuide
Цельногеномные дробовики
NCBI FieldGuide
Архив трассировки
NCBI FieldGuide
Следы короткохвостого опоссума
Все записи RefSeq NC в Entrez Genome
• Полный хромосомный
последовательности предоставляются
• Гены аннотированы
• Аннотация может быть
показано графически и
связаны с записями последовательности
NCBI FieldGuide
Просмотр простых геномов
NCBI FieldGuide
NCBI FieldGuide
Средство просмотра карт NCBI
• Домашняя страница Map Viewer
- Показывает все поддерживаемые организмы
- Предоставляет ссылки на геномный BLAST
• Страница обзора генома
- Предоставляет ссылки на отдельные хромосомы
- Отображает совпадения по геному графически
• Страница просмотра хромосом
- Позволяет интерактивный просмотр деталей аннотации
- Предоставляет множество карт, уникальных для каждого генома
NCBI FieldGuide
Просмотр сложных геномов
NCBI FieldGuide
Домашняя страница Map Viewer
Искать на картах
Геномный BLAST
Помощь по конкретным видам!
NCBI FieldGuide
Страница обзора генома
Сводка карты
Добавить или удалить карты
Мастер карта
с взорванным содержимым
Органы управления
NCBI FieldGuide
Страница просмотра хромосом
Контиг TPO!
NCBI FieldGuide
Сводка карты
Содержание карты сильно различается в зависимости от вида!
• Карты последовательностей
• Сборка сердечника
• Аннотационное свидетельство
• Клоны и маркеры
• Полиморфизмы
• Ссылки и функции
• Генетические карты
• Цитогенетические карты
• Карты связи
• Радиационные гибридные карты
NCBI FieldGuide
Контент карты
NCBI FieldGuide
Посмотреть сборку возле ТПО
NCBI FieldGuide
Сборка Chr.2
NCBI FieldGuide
Сборка хромосомы 2
NCBI FieldGuide
NCBI FieldGuide
Взгляд TPO
Ссылки на Entrez Nucleotide
Ссылки на Entrez Gene
Ссылки на инструменты и данные
Разрыв в сборке
Содержание карты сильно различается в зависимости от вида!
• Карты последовательностей
• Сборка сердечника
• Аннотационное свидетельство
• Клоны и маркеры
• Полиморфизмы
• Ссылки и функции
• Генетические карты
• Цитогенетические карты
• Карты связи
• Радиационные гибридные карты
Ab initio (модель)
ДНК GenBank
стандартное восточное время
NCBI FieldGuide
Контент карты
Записи GenBank не используются в
Согласованные EST
NCBI FieldGuide
Аннотации Свидетельства
Кластеры UniGene
Модели ab initio
Гомологи по белку BLAST
NCBI FieldGuide
Entrez Homologene

Полиморфизм гаптоглобина человека и его клиническое значение

Это исследование было выполнено с участием (80) субъектов (38 мужчин, 42 женщины) и 30 здоровых субъектов (15 мужчин, 15 женщин) в качестве контрольной группы в период с октября 2013 г. по май 2014 г., и оно было проведено в больнице Аль-Хусейн в провинции Аль-Мутанна / Ирак.Пациенты были разделены на три группы: 1-я с СД-II, 2-я с сердечными заболеваниями, 3-я с СД и сердечными заболеваниями в дополнение к контрольной группе. Все группы классифицируются по индексу массы тела (18-24,9 в норме, 25-39,9 сверх веса), изучены уровень сахара в крови натощак, липидный профиль (холестерин, триглицериды, липопротеины высокой плотности, липопротеины низкой плотности). Результаты показывают, что есть высокие значимые значения (p> 0,001) во всей дисперсии: он показал значительное повышение уровня холестерина, ЛПВП, ТГ и ЛПНП у пациентов с сахарным диабетом по сравнению с контрольной группой. результаты показали повышение уровня FBS у пациентов с сахарным диабетом по сравнению с контрольной группой со значимым (p <0.001). В случае пациентов с сердечными заболеваниями По сравнению с контрольной группой результаты показали достоверное повышение (p <0,001) уровня холестерина ЛПНП и ТГ, и значительное увеличение (p <0,001) ИМТ у пациентов. В 3-й группе результаты показывают что повышение уровня холестерина у пациентов с сердечными заболеваниями по сравнению с контрольной группой, но незначительное по сравнению с контролем. Исследование также показало наличие значительной разницы в уровнях ЛПНП, ТГ и ИМТ для всех пациентов с сердечными заболеваниями (p> 0.001) по сравнению с нормальными добровольцами. Данные также показывают, что существует отрицательная корреляция между каждой из следующих переменных: BMI с FBS, HDL, TG; ЛПНП с ФБС и возрастом, ТГ с СНО; в то время как между другими параметрами существует положительная корреляция. Выявлена ​​высокая корреляция между возрастом и FBS, CHO; ТГ с ФБС. Рост имел положительную связь с массой тела, возрастом, ТГ, а отрицательную — с ФБС, холестерином, ЛПВП, ЛПНП, ИМТ. В группе пациентов с сахарным диабетом корреляция между измеренными параметрами в результате этого исследования показывает, что корреляция между массой тела и ТГ, ЛПНП, ИМТ, ЛПВП и возрастом положительна, в то время как в группе пациентов с сердечными заболеваниями результат показывает, что корреляция между массой тела и ТГ, ЛПНП , ИМТ, ЛПВП, FBS и возраст положительны.в группе с сахарным диабетом и сердечными заболеваниями результат показывает, что корреляция между весом и ростом, ТГ, ЛПНП, ИМТ и возрастом положительна, а корреляция между холестерином, ФБС и ЛПВП отрицательна. Геномное исследование с использованием метода ПЦР с прямым и обратным праймером для каждого из H p1 и Hp2. В ПЦР с праймерами A и B (протокол 1) продукты длиной 1757 и 3481 п.н. амплифицировали из геномной ДНК, содержащей аллели Hp 1 и Hp 2, соответственно. После электрофореза с использованием 1% геля агарозного геля были получены картины полос, специфичные для генотипа Hp; генотипы Hp 1-1 и Hp 2-2 были охарактеризованы одиночными полосами, представляющими продукты длиной 1757 и 3481 п.о. соответственно.В присутствии продукта длиной 1757 п.о. невозможно было окончательно определить, присутствует ли также Hp 2-специфический продукт ПЦР длиной 3481 п.о. В этих случаях был выбран альтернативный протокол (протокол 2), состоящий из двух отдельных реакций: одна реакция с использованием праймеров A и B была направлена ​​на обнаружение Hp 1-специфического продукта длиной 1757 п.н., а другая реакция с использованием праймеры C и D были направлены на обнаружение Hp 2-специфического продукта длиной 349 п.н. Генотипы гаптоглобина 40 последовательных пациентов были определены с помощью геномной ДНК, полученной из образцов крови пациентов с диабетом сердца.

Менделирующее рандомизированное исследование транскриптома для выявления тканезависимых регуляторных механизмов в человеческом феномене


Предпосылки Изучение тканеспецифических механизмов транскрипции может помочь улучшить наше понимание того, как генетические варианты оказывают свое влияние на комплекс черты характера и болезни. Применяя принципы менделевской рандомизации, мы предприняли систематический анализ для оценки транскриптомных ассоциаций между экспрессией генов в 48 различных типах тканей и 395 сложными признаками.

Результаты В целом мы идентифицировали 100 025 ассоциаций генов и признаков на основе обычных поправок на весь геном (P <5 × 10 −08 ), которые также предоставили доказательства генетической колокализации. Эти результаты показали, что генетические варианты, которые влияют на уровни экспрессии генов во многих тканях, с большей вероятностью влияют на несколько сложных признаков. Мы идентифицировали множество примеров тканеспецифических эффектов, таких как генетически предсказанная экспрессия TPO , NR3C2 и SPATA13 , связанная только с заболеванием щитовидной железы в ткани щитовидной железы.Кроме того, экспрессия FBN2 была связана как с сердечно-сосудистыми, так и с легочными функциями, но только при анализе в тканях сердца и легких соответственно.

Мы также демонстрируем, что проведение общей оценки наших результатов может помочь выявить неблагоприятные побочные эффекты на мишени для терапевтического вмешательства, а также предложить возможности изменения положения лекарств. Более того, мы обнаружили, что изучение тканевой зависимости ассоциаций, выявленных с помощью полногеномных исследований ассоциаций (GWAS), может помочь выяснить причинные гены и ткани, ответственные за эффекты, а также выявить предполагаемые новые ассоциации.

Выводы Атлас тканезависимых ассоциаций, который мы построили, должен оказаться чрезвычайно ценным для будущих исследований генетических детерминант сложных заболеваний. Последующие анализы, которые мы провели в этом исследовании, являются просто руководством для будущих исследований. Систематически проводить аналогичные оценки можно на http://mrcieu.mrsoftware.org/Tissue_MR_atlas/.


Достижения в технологиях высокопроизводительного секвенирования предоставляют беспрецедентную возможность исследовать молекулярные детерминанты сложных заболеваний.Это облегчило идентификацию генетических вариантов, влияющих на экспрессию генов, известных как локусы количественных признаков экспрессии (eQTL). Недавние исследования продемонстрировали пользу использования данных eQTL, чтобы помочь понять основные механизмы результатов полногеномных ассоциативных исследований (GWAS) 1–3 . Более того, попытки использовать данные eQTL, полученные из разных типов тканей, могут помочь в дальнейшей оценке биологической и клинической значимости вариантов, связанных со сложными признаками 4–6 .В частности, эти усилия важны при исследовании тканевой специфичности, явления, при котором функция гена ограничивается конкретными типами тканей 7 .

Важной задачей молекулярной эпидемиологии является оценка того, как связь между экспрессией генов и сложными характеристиками зависит от анализируемой ткани. Ранее мы предложили аналитический конвейер для выявления ассоциаций между тканеспецифической экспрессией генов и сложными признаками, применяя принципы менделевской рандомизации (MR) 8–10 .Этот подход использует eQTL в качестве инструментальных переменных для исследования того, влияют ли генетические варианты в локусе как на экспрессию генов, так и на вариации сложных признаков. Кроме того, эта структура имеет преимущества по сравнению с альтернативными подходами, охватывающими весь транскриптом, за счет включения методов генетической колокализации 11, 12 . Это помогает снизить вероятность ложных результатов, приписываемых двум отдельным, но коррелированным вариантам в локусе, один из которых отвечает за влияние на экспрессию гена, а другой — на связанный комплексный признак.Таким образом, ассоциации, поддерживаемые доказательствами генетической колокализации, с большей вероятностью будут вызваны общим генетическим фактором. Важно отметить, что генетическая совместная локализация необходима, но недостаточна для причинности. Это связано с тем, что генетический эффект может влиять на ассоциированный признак из-за опосредованных изменений в экспрессии генов, или он может воздействовать на оба через независимые биологические пути 13 .

В этом исследовании мы применили нашу схему, чтобы всесторонне оценить связь между транскрипцией 32 116 кодирующих белок, РНК- и псевдогенов и 395 комплексных признаков.Это было предпринято для 48 типов тканей с использованием данных консорциума GTEx 14 (v7), а также данных, полученных из цельной крови проекта eQTLGen 15 (n = 31 684). С помощью этой предполагаемой причинно-следственной карты тканезависимых ассоциаций мы провели несколько обширных анализов. Во-первых, мы оценили взаимосвязь между экспрессией генов во многих тканях и плейотропией; феномен, при котором ген влияет на изменение нескольких признаков 16 . Затем мы провели серию анализов транскриптома и феномена, чтобы выявить тканезависимые ассоциации.Подобные открытия могут помочь в понимании лежащих в основе регуляторных механизмов, которые лежат на каузальном пути от генетического варианта до связанного с ним комплексного признака. Более того, они могут помочь обнаружить плейотропные эффекты, которые могут быть ограничены отдельными типами тканей.

Мы также демонстрируем, что оценки генов-мишеней в масштабах всего феномена имеют переводимую ценность. Например, они могут помочь предсказать, приведет ли терапевтическое вмешательство к потенциальным побочным эффектам на цель, а также предложить новые возможности для перепрофилирования лекарств.Это особенно привлекательно, учитывая предыдущие данные, согласно которым генетические ассоциации, поддерживающие терапевтическое вмешательство, могут повысить эффективность и безопасность. 17, 18 . Наконец, мы исследовали тканевую зависимость ассоциаций между выбранными генетическими вариантами, обнаруженными GWAS по признакам артериального давления. Наши результаты показывают, что интеграция тканеспецифичных данных eQTL может помочь определить приоритетность вероятных функциональных генов и тканей, ответственных за сигналы GWAS.


Построение атласа тканезависимых ассоциаций в человеческом феномене

Мы объединили данные eQTL из консорциума GTEx (v7) для 48 типов тканей (n = от 80 до 491, дополнительная таблица 1) и проекта eQTLGen с использованием результатов, полученных из цельной крови (n = 31 684).Полная сводная статистика по 395 комплексным признакам была получена из крупномасштабного GWAS (дополнительная таблица 2). Чтобы исследовать связь между транскрипцией до 32 116 генов (т.е. кодирующих белок, РНК и псевдогенов) и каждым признаком по очереди, мы применили сводную менделевскую рандомизацию с двумя выборками (2SMR) 19 и оценили генетическую совместную локализацию с использованием Метод неоднородности в зависимых инструментах (HEIDI) (v0.710) 2 . Мягкий порог p-значения P <1,0 × 10 -04 использовался для определения eQTL отведения в качестве инструментальных переменных в нашем анализе.Однако этот порог — просто эвристика для выделения ассоциаций, заслуживающих дальнейшего изучения 20 . Поэтому при исследовании результатов можно применять более (или менее) строгий порог путем фильтрации ассоциаций на основе p-значения для eQTL отведений в анализах. Все результаты можно визуализировать и загрузить с помощью нашего веб-приложения, расположенного по адресу http://mrcieu.mrsoftware.org/Tissue_MR_atlas/. Схема анализа нашего исследования может быть найдена на рисунке 1.

Рисунок 1

Схема плана анализа в этом исследовании

Каждый проведенный анализ был скорректирован с учетом обычных поправок для всего генома (т.е.е. MR P <5,0 × 10 -08 ) и отфильтрован для доказательства генетической колокализации (т.е. HEIDI P> 0,05 / количество обнаруженных ассоциаций). В общей сложности 100 025 ассоциаций MR были устойчивы к множественному тестированию и генетической колокализации на основе этих критериев. Мы также обнаружили, что ассоциации, полученные с использованием данных eQTLGen, были сильно обогащены ассоциациями с использованием данных цельной крови GTEx по сравнению с различными типами тканей из этого ресурса (P <1,0 × 10 -04 ).

Мы предположили, что варианты, которые влияют на уровни экспрессии генов во многих тканях, с большей вероятностью влияют на несколько сложных признаков.Чтобы исследовать это, мы сначала сгруппировали ассоциации в соответствии с органом, из которого были получены ткани (дополнительная таблица 3). Причина этого в том, что мы можем ожидать, что сходные ассоциативные сигналы будут разделяться между тканями в GTEx, которые были частью одной и той же эмбриональной ткани во время развития. Например, различные типы тканей головного мозга из консорциума GTEx (например, миндалина, мозжечок и т. Д.) Были отнесены к группе тканей «Мозг». Это должно было уменьшить количество ложноположительных результатов от эффективного подсчета одной и той же ассоциации дважды (например,г. экспрессия генов в различных типах тканей мозга, связанных с одним и тем же неврологическим признаком).

Мы выявили убедительные доказательства положительной взаимосвязи между количеством ассоциированных признаков для каждого отведения eQTL и количеством тканей, в которых они были обнаружены (бета = 0,60, SE = 0,02, P <1,0 × 10 −16 ). Этот анализ был скорректирован с учетом частот минорных аллелей, показателя неравновесия по сцеплению (LD) и расстояния до зонда экспрессии гена для ведущего eQTL, учитывая, что эти геномные свойства могут влиять на количество ассоциированных признаков для данного SNP.В последующем анализе мы сгруппировали эффекты eQTL на основе связанных с ними генов. В целом, наблюдалась положительная корреляция между количеством признаков, с которыми был связан каждый ген, и количеством различных групп тканей, в которых были обнаружены эти ассоциации (r 2 = 0,38, рис. 2).

Рис. 2

График в виде прямоугольников, изображающий корреляцию в нашем атласе, согласно которой генетически детерминированная экспрессия генов с большей вероятностью связана с несколькими признаками, если она выражена в нескольких различных типах тканей.

Транскриптомная оценка заболеваний щитовидной железы для выявления тканезависимых эффектов

Результаты нашего обширного анализа могут быть использованы для проведения исследований тканезависимых эффектов, основанных на гипотезах. Например, мы предположили, что генетические варианты, которые влияют на риск заболевания щитовидной железы (определяемого как самопровозглашенный гипотиреоз или микседема в исследовании UK Biobank), вероятно, могут действовать через изменения экспрессии генов в ткани щитовидной железы. На рисунке 3 показаны результаты оценки транскриптома между экспрессией генов, полученных из щитовидной железы, и заболеванием щитовидной железы с использованием результатов из нашего атласа.Мы выявили 58 ассоциаций, которые пережили многократное тестирование (P <5,66 × 10 −06 , т.е. тест 0,05 / 8834), и 33 из них пережили фильтрацию HEIDI (P> 8,62 × 10 −04 на основе тестов 0,05 / 58) ( Дополнительная таблица 4). Однако 12 из них находились в области HLA и должны интерпретироваться с осторожностью из-за обширного неравновесия по сцеплению, которое может снизить надежность генетических анализов колокализации 21 .

Рисунок 3

Манхэттенский график, иллюстрирующий связь между генетически измененной экспрессией генов, полученных из ткани щитовидной железы, и заболеванием щитовидной железы, о котором сообщают сами пациенты, в исследовании UK Biobank.Среди сигналов, устойчивых к генетической колокализации, мы определили ассоциации, обнаруживаемые только с использованием ткани щитовидной железы (красный цвет), ассоциации, обнаруженные с самыми сильными доказательствами в ткани щитовидной железы (т. Е. Доказательства связи по крайней мере в 2 тканях с самой сильной щитовидной железой — желтый цвет) и наблюдаемые ассоциации. во многих различных типах тканей (т. е. свидетельство ассоциации по крайней мере в 2 тканях, где щитовидная железа не самая сильная — пурпурный).

Мы оценили связь каждого из этих генетических эффектов на заболевание щитовидной железы во всех других доступных типах тканей.Хотя мы сообщаем об этих генетических эффектах на основе соответствующих им символов генов, следует отметить, что они основаны на оценках MR-эффекта с использованием ведущего eQTL. Мы обнаружили, что, в частности, 3 из этих ассоциаций оказались в высокой степени тканеспецифичными ( TPO , NR3C2 и SPATA13 ), поскольку они были идентифицированы в ткани щитовидной железы только после корректировки количества оцениваемых тканей (дополнительные таблицы 5–5). 7). Межтканевые ассоциации для TPO и заболевания щитовидной железы показаны на рисунке 4a.Эти эффекты предоставили убедительные доказательства гетерогенности (статистика Кокрана Q = 104,8, P = 7,12 × 10 −14 ), что отражает тканевую зависимость ассоциаций для TPO .

Рисунок 4

Лесные графики для тканезависимых эффектов, выявленных в нашем анализе между генами, связанными с заболеванием щитовидной железы. a) ассоциация для TPO оказалась тканезависимой и наиболее сильно ассоциированной в ткани щитовидной железы, b) тогда как экспрессия RPS26 была прочно связана во всех оцениваемых тканях.Горизонтальные линии на этих графиках указывают нуль бета = 0.

Мы также определили эффекты, наиболее сильно обнаруживаемые в ткани щитовидной железы, хотя доказательства ассоциации все еще были выявлены в других типах тканей ( VAV3 , LRRFIP2 , SGK223 и SUOX , дополнительная таблица 8–11). Эти результаты также демонстрируют, что определенные ассоциации, по-видимому, обнаруживаются во многих или во всех оцениваемых типах тканей. Например, связь между RPS26 и заболеванием щитовидной железы была обнаружена во всех 48 типах тканей, оцененных, как показано на рисунке 4b (дополнительная таблица 12).В отличие от TPO , имелись слабые доказательства гетерогенности для RPS26 (статистика Кокрена Q = 27,1, P = 0,99), что отражало устойчивые ассоциации для всех проанализированных тканей.

Проведение анализа ассоциаций на уровне всего феномена для оценки тканезависимых эффектов

Наряду с оценкой наших результатов на уровне транскриптома, как указано выше, изучение результатов на уровне всего феномена может быть мощным подходом к исследованию плейотропии. В качестве демонстрации этого в предыдущем анализе мы установили, что RPS26 тесно связан с заболеванием щитовидной железы во многих различных тканях.Проведение сканирования экспрессии этого гена по всему феномену с использованием цельной крови предполагает, что соответствующий вариант, используемый в качестве инструмента, является высокоплейотропным, поскольку в общей сложности 48 ассоциаций выдержали многократное тестирование и исправления HEIDI (дополнительная таблица 13 и рисунок 5a). RPS26 , таким образом, представляется показательным примером того, что гены, экспрессируемые во многих тканях, с большей вероятностью могут влиять на несколько различных фенотипов.

Рис. 5

Графики в Майами, иллюстрирующие феноменальные ассоциации между генами в различных типах тканей.a) RPS26 Экспрессия , полученная из цельной крови, была связана со многими различными признаками, b) Экспрессия FBN2 , полученная из сердечной ткани, была связана с характеристиками артериального давления, c) FBN2 ассоциаций с кровяным давлением ослаблялись при анализе с использованием полученных из легких данные. Однако вместо этого наблюдались другие ассоциации (например, показатели функции легких).

Изучение ассоциаций интересующих генов в масштабе всего феномена также может дать представление о тканезависимых эффектах.В качестве примера мы оценили гены в нашем атласе, связанные с двумя признаками со значительным наследуемым компонентом в рамках исследования UK Biobank; диастолическое артериальное давление и форсированная жизненная емкость легких (ФЖЕЛ). Мы обнаружили, что экспрессия FBN2 была связана с обоими признаками в наших результатах, хотя при использовании данных, полученных из ткани сердца, наблюдались только эффекты на кровяное давление (дополнительная таблица 14 и рисунок 5b). Однако эти ассоциации ослабевают при исследовании этого эффекта на других типах тканей.Более того, при оценке ассоциаций FBN2 по всему феномену с использованием данных eQTL, полученных из легочной ткани, мы выявили доказательства ассоциации с FVC (MR P = 3,51 × 10 -06 , дополнительная таблица 15 и рисунок 5c). Подобные результаты можно отнести к разным eQTL, используемым в качестве инструментальных переменных для одного и того же гена, но в пределах другого типа ткани (как в случае FBN2 ). Таким образом, они могут прояснить тканезависимые регуляторные механизмы, которые могут помочь объяснить ассоциации в плейотропных локусах 22 .

Использование результатов для выявления потенциальных побочных эффектов терапевтического вмешательства и возможностей изменения положения лекарств

Изучение наших ассоциаций в масштабах всего феномена также может быть полезным для других целей, таких как помощь в проверке того, могут ли гены быть жизнеспособными мишенями для лекарств 23 . Хорошо известным примером этого является влияние ингибирования HMG-кофермента A редуктазы (HMG-CoA) с помощью статинов, которые, как известно, снижают уровень холестерина липопротеинов низкой плотности (LDL).Однако известно, что это также потенциально может привести к увеличению массы тела и риску диабета 24 .

Проведение общей оценки HMGCR (гена, ответственного за HMG-CoA) с использованием данных, полученных из ткани скелетных мышц, подтверждает эти выводы. После удаления ассоциаций, которые не выдержали поправок HEIDI, мы наблюдали сильные положительные ассоциации между ведущим eQTL для этого гена и высокими уровнями ЛПНП и общего холестерина (дополнительная таблица 16 и рисунок 6a).Мы также выявили доказательства связи с более низким индексом массы тела (MR P = 1,63 × 10 -05 ), хотя связь с самооценкой диабета не выдержала поправок на уровне феномена (MR P = 0,002). Тем не менее, эти результаты подтверждают мнение о том, что менделевский рандомизационный анализ может помочь имитировать результаты рандомизированных контрольных исследований 25 и выявить потенциальные побочные эффекты терапевтического вмешательства 26 . Однако мы отмечаем, что анализируемая ткань может играть важную роль в таких анализах, особенно в отношении чувствительности генетической колокализации.Например, повторные оценки HMGCR с использованием данных цельной крови, полученных из eQTLGen, показывают, что сигналы ассоциаций менее устойчивы к совместной локализации в этой ткани (например, HEIDI P = 1,8 × 10 -06 с холестерином ЛПНП). В целом, однако, сравнения наших результатов между тканями следует интерпретировать с осторожностью из-за различий в размерах выборок наборов данных eQTL, полученных от консорциума GTEx.

Рисунок 6

Графики Майами, представляющие феноменальные ассоциации между генами, предназначенными для терапевтического вмешательства.a) ассоциации HMGCR отражают известные последствия применения статинов; b) ассоциации CYP19A1 поддерживают неблагоприятные побочные эффекты на целевые уровни минеральной плотности костей; c) ассоциации ACHE демонстрируют возможности для новых возможностей перепрофилирования (например, возможное ингибирование для снижения артериального давления. ).

Более новая демонстрация выделения потенциальных побочных эффектов была выявлена ​​путем проведения аналогичного анализа экспрессии CYP19A1 с использованием данных, полученных из цельной крови (дополнительная таблица 17 и рисунок 6b).Этот ген ранее был нацелен на использование препарата Анастрозол для снижения риска рака груди 27 , хотя сообщенные побочные эффекты включают повышенный риск остеопороза 28 . Наше феноменальное сканирование CYP19A1 предоставило доказательства этого нежелательного воздействия на цель, поскольку мы выявили убедительные доказательства связи с минеральной плотностью пяточной кости (МПК) (MR P = 1,96 × 10 −07 ).

Проведение таких оценок также может быть полезно для потенциальных возможностей репозиционирования лекарств.Например, ACHE , который является мишенью для лекарств, используемых для лечения когнитивных нарушений у пациентов с болезнью Альцгеймера, таких как галантамин и донепезил 29 . Вероятно, можно ожидать, что причинный путь, на который нацелены эти препараты, будет ингибировать экспрессию ACHE в ткани мозга. Однако проведение общей оценки этого гена в других тканях (таких как артерия аорты) показывает, что его транскрипция связана с более высоким кровяным давлением (дополнительная таблица 18 и рисунок 6c).Таким образом, дальнейшие исследования могут помочь выяснить, может ли подавление продукта этого гена иметь положительные последствия для гипертонии.

Использование данных тканеспецифической экспрессии для выяснения генов, ответственных за сигналы ассоциации

Важной задачей в генетической эпидемиологии является определение причинного гена, ответственного за сигналы ассоциации, обнаруживаемые GWAS. Это сложная проблема по нескольким причинам, включая коэкспрессию, которая может существовать между соседними генами, которую часто трудно распутать. 30 .Ранее мы предположили, что объединение тканеспецифичных данных eQTL с данными GWAS может помочь в таких усилиях. 9 .

Например, rs7500448 тесно связан с диастолическим артериальным давлением (ДАД) (после корректировки на лекарства) на основе анализа, проведенного с использованием данных исследования UK Biobank (P = 6,3 × 10 −15 ). Использование всех доступных тканезависимых результатов из нашего атласа позволило нам оценить ассоциации между соседними генами, для которых этот SNP является eQTL.При этом был идентифицирован только один сигнал ассоциации, который выдержал множественные сравнения, а именно CDh23 с использованием данных eQTL, полученных из аорты (MR P = 2,78 × 10 -08 ) (дополнительная таблица 19 и рисунок 7a). Это дает убедительные доказательства того, что CDh23 может быть причинным геном, ответственным за этот эффект, и что его экспрессия в аорте может играть роль в изменении артериального давления.

Рисунок 7

Майами строит графики между всеми генами, на экспрессию которых влияют SNP, обнаруженные с помощью полногеномных ассоциативных исследований (GWAS) признаков кровяного давления.a) rs7500448 был сильно связан с диастолическим артериальным давлением (ДАД) на основе экспрессии CDh23 , полученной из ткани аорты, b) rs72795295 был связан с частотой пульса с использованием SLC27A6, экспрессии, полученной из сердца, c) rs1706003 был связан с DBP с использованием Данные по экспрессии ATP13A3 также получены из ткани сердца.

Этот подход также может оказаться полезным при идентификации вариантов, связанных с признаками, которые еще предстоит обнаружить GWAS. Например, rs72795295 наиболее сильно связан с частотой пульса из характеристик, связанных с артериальным давлением в нашем анализе, хотя этот эффект не выдерживает обычных корректировок множественного тестирования GWAS (P = 7.2 × 10 −08 ). Однако за счет интеграции тканеспецифичных данных eQTL наряду с уменьшением нагрузки на множественное тестирование наш анализ предоставил доказательства, позволяющие предположить, что это может быть новый локус, связанный с признаками (дополнительная таблица 20 и рисунок 7b). Более того, самая сильная связь в этой оценке была с экспрессией SLC27A6 , происходящей из сердечной ткани (MR P = 7,8 × 10 -07 ), что снова может помочь дать механистическое понимание причинного пути от генетического варианта к фенотипу.

Аналогичным образом, rs1706003 представляет собой SNP, связанный с артериальным давлением, который может быть упущен из виду на основе обычных поправок GWAS (P = 1,1 × 10 -07 с DBP). Объединение данных eQTL, полученных из сердца, с данными GWAS предоставило доказательства, которые пережили множественные сравнения в нашем анализе (MR P = 7,8 × 10 -07 ) (дополнительная таблица 21 и рисунок 7c). Более того, хотя ближайшим к rs1706003 геном является TMEM44 , наши результаты показывают, что ген, расположенный дальше по ходу цепи, с большей вероятностью отвечает за этот эффект ( ATP13A3 ).Подобные результаты подтверждают, что ближайший ген к SNP, ассоциированному с признаком, не всегда является причинным. 31 .


В этом исследовании мы предприняли систематическое исследование ассоциации в масштабе всего феномена, чтобы изучить генетические эффекты экспрессии генов в различных типах тканей. Поступая таким образом, мы построили предполагаемую причинную карту тканезависимых ассоциаций в человеческом транскриптоме. Мы предоставили доказательства того, что эффекты, влияющие на экспрессию генов в нескольких типах тканей, с большей вероятностью связаны с несколькими признаками.Наши результаты также подчеркивают ценность перекрестных оценок тканей с точки зрения выяснения эффектов, которые зависят от анализируемой ткани. Мы предполагаем, что наши результаты будут способствовать более глубокому пониманию тканеспецифических регуляторных механизмов, которые, вероятно, будут иметь трансляционное воздействие путем информирования о приоритезации мишеней для лекарств.

Известно, что ткани или типы клеток, в которых экспрессируется ген, отражают биологические процессы и функции, которые он выполняет. 32 . Например, в этом исследовании мы продемонстрировали, что связь между TPO и заболеванием щитовидной железы, по-видимому, зависит от использования данных экспрессии, полученных из ткани щитовидной железы.Этот ген отвечает за выработку пероксидазы щитовидной железы и, таким образом, играет важную роль в регулировании гормонов щитовидной железы 33 . Как таковая, эта тканеспецифическая ассоциация отражает роль, которую этот ген играет в щитовидной железе. Напротив, связь между RPS26 и заболеванием щитовидной железы была обнаружена во всех оцениваемых тканях. Более того, отсутствие гетерогенности, обнаруженное в этой оценке поперечных тканей, предполагает, что функциональная роль RPS26 установлена ​​на ранней стадии развития.Этот ген кодирует рибосомный белок, необходимый для производства 18S рРНК, структурной РНК, которая является компонентом всех эукариотических клеток 34 . Наши результаты показали, что, наряду с заболеванием щитовидной железы, RPS26 был связан с 47 другими признаками, которые пережили множественные сравнения. Таким образом, большое количество идентифицированных эффектов, по-видимому, отражает функцию RPS26 , которая, вероятно, имеет решающее значение для многих сложных биологических путей. В целом мы также наблюдали, что варианты, которые влияют на уровни экспрессии генов во многих тканях, с большей вероятностью влияют на несколько сложных признаков.Это предполагает, что гены, экспрессируемые во многих тканях, с большей вероятностью будут иметь широкое влияние на последующие фенотипические последствия.

В наших результатах мы продемонстрировали, что оценка генов в масштабе всего феномена может помочь выяснить тканезависимые ассоциации. В качестве примера мы показываем, что FBN2 связан с различными характеристиками артериального давления при использовании данных экспрессии, полученных из ткани сердца. Однако при анализе экспрессии FBN2 с использованием данных, полученных из легких, эти эффекты ослаблялись, тогда как доказательства связи с функцией легких и импедансом были обнаружены.Этот ген отвечает за кодирование фибриллина 2, гликопротеина, ответственного за эластиновые волокна, обнаруженные в соединительной ткани 35 . Эластин играет важную роль в определении пассивных механических свойств крупных артерий и легких, что помогает объяснить ассоциации, обнаруженные в этих отдельных тканях 36, 37 . FBN2 также связан с другими признаками и заболеваниями, такими как марфановское расстройство 35 . Лучшее понимание плейотропных эффектов, обусловленных регуляторными механизмами, также может помочь пролить свет на действующие инструменты в условиях традиционной менделевской рандомизации (т.е. между изменяемым фактором риска окружающей среды и исходом заболевания ( 8 ). В частности, указание количества экспрессий генов, на которое влияет инструмент (и количества различных типов тканей), было бы ценным в обычных условиях МРТ.

Оценка наших результатов в рамках всего фенома также может помочь в приоритезации целевых лекарственных средств. Это подтверждает новые данные о пользе использования результатов исследований генетических ассоциаций для подтверждения терапевтической валидации 38, 39 .Более того, это особенно важно с учетом затрат на разработку лекарств 40 , но также своевременно, учитывая, что наибольшее количество новых лекарств было одобрено в 2018 году 41 . В качестве доказательства концепции мы провели сканирование всего феномена HMGCR , на который нацелены статины для снижения повышенного уровня холестерина. Мы выявили сильную связь с характеристиками холестерина, а также результаты, которые отражают известные целевые эффекты статинов (а именно изменения массы тела и риск диабета 24 ).Таким образом, хотя наборы данных GWAS обычно исследуют заболеваемость, а не ее прогрессирование или лечение, такие оценки могут быть полезны для терапевтической валидации 23 .

Наши результаты также могут быть использованы для обозначения целевых эффектов, которые менее хорошо изучены в фармакогенетике. Например, наша оценка CYP19A1 показала, что ингибирование этой цели может привести к снижению минеральной плотности костной ткани. Это открытие подтверждает побочный эффект, о котором ранее сообщалось для противоракового препарата анастрозол, нацеленного на этот ген 28 .Было обнаружено, что терапевтическая польза статинов в отношении снижения риска ишемической болезни сердца перевешивает неблагоприятные побочные эффекты в отношении риска диабета 42 . Выявление потенциальных побочных эффектов для других лекарственных препаратов должно мотивировать будущие попытки оценить, перевешивают ли преимущества терапевтического вмешательства возможные недостатки. Подобные оценки могут также помочь выявить потенциальные возможности перепрофилирования и изменения положения лекарств. Мы приводим пример этого, предполагая, что нацеливание на ACHE (первоначально предназначенное для лечения когнитивных нарушений у пациентов с болезнью Альцгеймера) может помочь снизить уровень артериального давления.Вероятно, есть много других потенциальных ассоциаций из нашего анализа, которые могут выявить потенциальные возможности перепрофилирования / репозиционирования лекарств.

В последней серии анализов в нашем исследовании мы предполагаем, что интеграция тканеспецифичных данных eQTL в анализ GWAS может помочь выделить гены, ответственные за сигналы ассоциации. Таким образом, наш подход поддерживает идею триангуляции в эпидемиологии, в соответствии с которой необходимо множество доказательств, чтобы поддержать надежные выводы (т. Е. Совместная локализация эффектов eQTL и GWAS) 43 .Примеры, которые мы продемонстрировали в этом отношении, включают SNP, связанные с характеристиками артериального давления, где мы отдаем приоритет CDh23 , SLC27A6 и ATP13A3 как генам, которые, вероятно, ответственны за эти эффекты. CDh23 является регулятором ремоделирования сосудистой стенки и ангиогенеза 44 , SLC27A6 отвечает за белок-переносчик жирных кислот 45 и ATP13A3 недавно был вовлечен в предрасположенность к легочной артериальной гипертензии через анализ редкой потери функции 46, 47 .Однако, хотя, вероятно, существует много случаев, когда интеграция тканеспецифичных данных eQTL может помочь точно определить гены, ответственные за ассоциации GWAS, это не всегда возможно из-за сложности коэкспрессии и широко экспрессируемых генов.

Усилия, которые продолжают генерировать все более крупномасштабные наборы молекулярных данных по тканям, будут способствовать возможности интеллектуального анализа данных в человеческом транскриптоме 48 . Несмотря на то, что нынешние размеры выборки означают, что анализы в этом исследовании были ограничены использованием только ведущего eQTL, будущие усилия выиграют от использования нескольких действенных инструментов в рамках структуры менделевской рандомизации.Тем не менее, методы генетической колокализации, вероятно, будут продолжать играть важную роль в определении того, обнаруживаются ли ассоциации из-за общих причинных вариантов. Мы также отмечаем, что вывод о методах колокализации может быть ограничен при оценке ассоциаций в локусах плотного неравновесного сцепления (например, в области HLA генома).

Более того, подход, использованный в нашем исследовании (как и все альтернативы на сегодняшний день), не может полностью исключить, что на результаты может влиять молекулярная горизонтальная плейотропия.Это процесс, при котором генетический вариант влияет на экспрессию гена и сложный признак двумя независимыми биологическими путями. Мы также отмечаем, что кросс-тканевый вывод наших результатов предусматривает разный размер выборки в GTEx для разных тканей. Наконец, при оценке ассоциаций в наших результатах важно помнить, что они основаны на размерах эффекта SNP, которые часто относительно скромны ( 49 ), но потенциально эффективны на протяжении всей жизни. Поэтому, оценивая наши результаты с целью валидации лекарств, стоит отметить, что фармацевтическое нацеливание на белок, вероятно, будет иметь большее влияние на уровни белка, но в течение более короткого периода времени.

Результаты, которые мы выделили в нашем исследовании, вероятно, являются лишь верхушкой айсберга с точки зрения новых результатов из нашего атласа, которые дают представление о регуляторных механизмах, лежащих в основе сложных черт человека. Хотя в исследованиях ранее использовались данные GTEx для изучения тканевой специфичности, их результаты нелегко получить в формате, который позволяет проводить оценки на уровне транскриптома, феномена или между тканями. Наше веб-приложение должно оказаться полезным для пользователей в этом отношении, облегчая углубленную оценку текущих результатов или мотивируя инновационные исследовательские гипотезы.Будущие попытки использовать все более крупномасштабные наборы молекулярных данных, полученные из различных типов тканей, улучшат нашу способность понимать детерминанты сложных заболеваний.


Ресурсы данных

Тканеспецифичные данные eQTL были получены из проекта экспрессии генотипа в тканях (GTEx) (v7) (https://gtexportal.org/home/). Были проанализированы только 48 из 53 тканей, доступных в GTEx v7, поскольку в каждой из оставшихся 5 было менее 50 образцов. Мы также получили данные eQTL, полученные из цельной крови у 31 684 человек, предоставленные консорциумом eQTLGen (http: // www.eqtlgen.org). Сводная статистика GWAS была получена в результате анализа лабораторией Нила данных британского биобанка и консорциумов, которые сделали свои результаты общедоступными (полный список можно найти в дополнительной таблице 2).

Статистический анализ

Мы провели анализ, используя метод менделевской рандомизации на основе сводных данных (SMR) (v0.710). Контрольная панель европейских людей из проекта 1000 геномов (фаза 3) использовалась для вычисления оценки LD для всех анализов 50 .Как было предложено ранее 51 , только cis-eQTL использовались в качестве инструментальных переменных (на основе <1 МБ связанной пробы). Это сделано для уменьшения вероятности ассоциаций, связанных с горизонтальной плейотропией, к которой транс-эффекты более подвержены.

Следовательно, только ведущие eQTL для каждого гена использовались в качестве инструментальных переменных, учитывая, что очень немногие гены могли быть надежно инструментами с несколькими независимыми SNP в наборе данных GTEx. Этот подход также применялся при анализе данных из консорциума eQTLGen, несмотря на большие размеры выборки, для согласованности при сравнении ассоциаций между наборами данных.Мы определили eQTL на основе мягкого порога p-значения P <1 × 10 -04 , максимизируя количество возможных генов, анализируемых по тканям, но также позволяя читателям отфильтровать ассоциации, если они захотят применить более строгий порог.

Модель дисперсионного анализа (ANOVA) была применена для исследования связи между количеством признаков и количеством типов тканей, обнаруженных для всех отведений eQTL в наших тщательно отобранных результатах (т.е. P <5 × 10 −08 , которые также были надежными. в исправления HEIDI).Однако также возможно, что свойства генома (такая, как неравновесная структура сцепления (LD), близость к ближайшему гену и т. Д.) Могут влиять на количество признаков, с которыми связаны многотканевые eQTL. Поэтому мы скорректировали наш анализ на частоту минорных аллелей, показатель неравновесия по сцеплению (LD) и расстояние до зонда экспрессии гена для ведущего eQTL. Кроме того, ассоциации, обнаруженные с использованием данных, полученных из цельной крови eQTLGen, были удалены из этого анализа, чтобы уменьшить любую систематическую ошибку, которая может быть связана с большим размером выборки этого набора данных.

По умолчанию наше веб-приложение отображает несколько сравнений тестов на основе поправки Бонферрони на количество тестов, выполненных в поисковом запросе. Впоследствии применяются поправки HEIDI, основанные на количестве ассоциаций, прошедших многократное тестирование в этом поиске.

Все анализы проводились с использованием R (версия 3.5.1). Пакет R «shiny» v1.1 использовался для разработки веб-приложения. Для создания интерактивных графиков использовались пакеты R «manhattanly» v0.2 и «highcharter» v0.5.Рисунки в этой рукописи были созданы с использованием «ggplot2» v2.2.1.

Конкурирующие интересы

Авторы заявляют об отсутствии конфликта интересов.

Материалы и переписка

Настоящая публикация является работой авторов и T.G.R. будет служить гарантом содержания данной статьи.


Мы чрезвычайно благодарны консорциумам GTEx, eQTLGen и GWAS за то, что их сводные статистические данные стали общедоступными для целей данного исследования.Эта работа была поддержана отделом интегративной эпидемиологии, который получает финансирование от Совета медицинских исследований Великобритании и Бристольского университета (MC_UU_00011 / 1, MC_UU_00011 / 4 и MC_UU_00011 / 5). G.D.S, C.L.R и T.R.G проводят исследования в Центре биомедицинских исследований NIHR при университетских больницах Bristol NHS Foundation Trust и в Бристольском университете. Мнения, выраженные в этой публикации, принадлежат автору (авторам) и не обязательно принадлежат NHS, Национальному институту исследований в области здравоохранения или Министерству здравоохранения.G.H поддерживается фондом Wellcome Trust [208806 / Z / 17 / Z]. T.G.R — научный сотрудник UKRI по исследованиям в области инноваций (MR / S003886 / 1).

73-й Конгресс Итальянского общества педиатров | Итальянский педиатрический журнал

Серенелла Кастронуово

1 , Джампаоло де Лука 2
1 Семейный педиатр, Gruppo di Studio Nazionale Adolescenza della SIP, Неттуно (РМ), 00048, Италия; 2 Семейный педиатр, Gruppo di Studio Nazionale Adolescenza della SIP, Козенца, 87100, Италия
Для переписки: Серенелла Кастронуово ([email protected])

Расстройства пищевого поведения все чаще проявляются в раннем возрасте. DSM-5 [1] изменил нозографию нарушений пищевого поведения, названную здесь «Расстройства питания и приема пищи» (FED). FED — это стойкие нарушения питания или поведения, которые определяют фальсифицированное потребление или ассимиляцию пищи и которые значительно угрожают физическому здоровью или социальному поведению. Они делятся на следующие категории:

  1. 1.


  2. 2.

    Расстройство жевания

  3. 3.

    Расстройство избегания / ограничения приема пищи

  4. 4.

    Нервная анорексия

  5. 5.

    Нервная булимия

  6. 6.

    Компульсивное переедание

  7. 7.

    Расстройство кормления и питания по спецификации

  8. 8.

    Расстройство кормления и питания без спецификации

Первые три категории особенно связаны с расстройствами пищевого поведения в детском возрасте.Расстройство пика и руминации теперь рассматривается как FED: согласно этим новым критериям возрастное ограничение, которое ранее использовалось для постановки диагноза, теперь отменено.

Было отмечено, что начало нервной анорексии, нервной булимии и компульсивного переедания, уже включенных в число расстройств пищевого поведения в DSM IV TR, у детей происходит раньше и раньше.

ФЭД — многофакторные заболевания [2, 3], частота которых резко возрастает в подростковом возрасте [4, 5, 6], характеризующиеся:

  • Изменение режима кормления

  • Экстремальная забота о своей физической форме

  • Неправильное восприятие внешнего вида тела

Между этими факторами и уровнем самооценки существует тесная корреляция.

Патогенетическая гипотеза ФЭД: часто наблюдается нестабильность симптоматических проявлений, связанных с трансдиагностической миграцией, поэтому в настоящее время существует убеждение, что различные ФЭД являются одним и тем же субъектом с разными симптоматическими проявлениями в зависимости от возраста и развития клиники.

Диагноз сложный, особенно в раннем подростковом возрасте (8-12 лет) [3, 7, 8, 9]. Семейный педиатр обычно знает ребенка с момента его / ее рождения и следит за его / ее ростом, как физически, так и психологически, и поэтому является первым, кто может перехватить с помощью простых диагностических тестов (например, EAT 26) первые признаки эти состояния, и от этого зависит последующий диагноз, терапия и прогноз [10,11,12,13,14,15,16,17,18].

Далее роль семейного педиатра:

  • Оценить тяжесть заболевания путем тщательного медицинского обследования и, в конечном итоге, лабораторных анализов. Анализ крови не является диагностическим, но помогает определить тяжесть заболевания [19,20,21,22].

  • Для оценки психологической ситуации с целью выявления ситуаций высокого риска, таких как тяжелая депрессия, тревога, членовредительство, злоупотребление наркотиками или другими веществами.

  • Для дифференциальной диагностики с другими органическими заболеваниями (эндокринными, желудочно-кишечными, психоневрологическими, инфекционными)

Важно, чтобы семейный педиатр осознавал необходимость направить пациента в структуру второго уровня, и для этого необходим диагностический подозреваемый.

Список литературы

1.Американская психиатрическая ассоциация. Диагностическое и Статистическое Руководство по Психическим Расстройствам. 5. Вашингтон: American Psychiatric Publishing; 2013. Кормление и расстройства пищевого поведения; п. 329–354. ДСМ-5.

2. Брукс С.Дж., Раск-Андерсен М., Бенедикт К., Шёт HB. Дискуссия о текущих диагнозах расстройств пищевого поведения в свете результатов нейробиологии: пришло ли время для модели спектра? BMC Psychiatry. 2012. с. 12–76.

3. Далла Раджионе Л. Я беспокоюсь о питании: современная эпидемия.В: Presidenza del Consiglio dei Ministri, Dipartimento della Gioventù. Il coraggio di guardare: prospettive ed incontri per la превентивное нарушение условий жизни. Глаз 03 Рома. 2012. с. 19–34.

4. Пауэрс ПС, Сантана, Калифорния. Расстройства пищевого поведения: руководство для терапевта. Prim Care. 2002; 29: 81–98.

5. Фаверо А., Карегаро Л., Тенкони Э, Боселло Р., Сантонастасо П. Возрастные тенденции в начале нервной анорексии и нервной булимии. J Clin Psychiatry. 2009; 70: 1715–21.

6. Далле Грейв Р. Расстройства пищевого поведения: успехи и проблемы. Eur J Int Med. 2001; 22: 153–60.

7. Ласк Б., Брайант-Во Р., Райт Ф., Кэмпбелл М., Уиллоуби К., Уоллер Г. Консультации семейного врача указывают на высокий риск возникновения нервной анорексии с ранним началом. Int J Eat Disord. 2005; 38: 269–72.

8. Сигель Э. Расстройства пищевого поведения. Adolesc Med. 2008; 19: 547–72.

9. Центры по контролю и профилактике заболеваний (CDC) Итон Д.К., Канн Л., Кинчен С., Шанклин Флинт К.Х., Хокинс Дж. И др.Эпиднадзор за рискованным поведением среди молодежи — США, 2011 г. MMWR Surveill Summ. 2012; 61: 1–162.

10. Американская академия педиатрии; Комитет по подростковому возрасту. Выявление и лечение расстройств пищевого поведения у детей и подростков. Педиатрия. 2010; 126: 1240–53. DOI: 10.1542 / peds.2010-2821.

11. Николлс Д., Хадсон Д., Магомед Ф. Управление нервной анорексией. Arch Dis Child. 2011; 96: 977–82.

12. Маэстро С., Барончелли Г.И., Гионе С., Бертеллони С. Я нарушаю правила питания в подростковом возрасте.Проспеттив в педиатрии. 2013; 170: 74–83.

13. Мартин Х., Аммерман С.Д. Подростки с расстройствами пищевого поведения. Скрининг первичной медико-санитарной помощи, выявление и раннее вмешательство. Nurs Clin North Am. 2002; 37: 537–551.

14. Ямамото К., Уэмото М., Шинфуку Н., Маэда К. Полезность тестов образа тела в профилактике расстройств пищевого поведения. J Med Sci. 2007; 53: 79–91.

15 .Джонстон О., Форнаи Дж., Кабрини С., Кендрик Т. Осуществимость и приемлемость скрининга на расстройства пищевого поведения в учреждениях первичной медико-санитарной помощи.Fam Pract. 2007; 24: 511–7.

16. Энгельсен Б.К., Хагвет К.А. Обобщающее исследование теста отношения к еде (EAT-12) у неклинических подростков. Расстройство питания и веса. 1999; 4: 179–186.

17. Анстин Д., Гриненко Д. Экспресс-скрининг на расстройство пищевого поведения у женщин студенческого возраста в учреждениях первичной медико-санитарной помощи. J Здоровье подростков. 2000; 26: 338–342.

18. Гарнер Д.М., Олмстед М.П., ​​Бор Ю., Гарфинкель П.Е. Тест отношения к еде: психометрические характеристики и клинические корреляты.Psychol Med. 1982; 12: 871–8.

19. Уинстон А.П., Барнард Д., Д’Суза Дж., Шад А., Шерлала К., Сидху Дж. И др. Герминома шишковидной железы, проявляющаяся как нервная анорексия: описание случая и обзор литературы. Int J Eat Disord. 2006; 39: 606–8.

20. Кроуфорд Дж. Р., Санти М. Р., Везина Г., Мисерос Дж. С., Китинг Р.Ф., ЛаФонд Д.А. и др. Опухоль зародышевых клеток ЦНС (CNSGCT) в детстве: представление и поздний диагноз. Неврология. 2007; 68: 1668–73.

21. Андреу Мартинес Ф. Дж., Мартинес Матеу Дж. М.. Опухоль внутричерепных зародышевых клеток, имитирующая нервную анорексию.Clin Transl Oncol. 2006; 8: 915–8.

22. Коул Т.Дж., Флегал К.М., Николлс Д., Джексон А.А. Отсечения индекса массы тела для определения худобы у детей и подростков: международный опрос. BMJ. 2007; 28: 194.

NCBI FieldGuide 29 сентября 2004 г. ICGEB NCBI Molecular Biology Resources A Field Guide part ppt download

Презентация на тему: «NCBI FieldGuide, 29 сентября 2004 г. ICGEB NCBI Molecular Biology Resources A Field Guide part 1.» — Стенограмма презентации:

ins [data-ad-slot = «4502451947»] {display: none! important;}} @media (max-width: 800px) {# place_14> ins: not ([data-ad-slot = «4502451947»]) {display: none! important;}} @media (max-width: 800px) {# place_14 {width: 250px;}} @media (max-width: 500 пикселей) {# place_14 {width: 120px;}} ]]>

1 NCBI FieldGuide 29 сентября 2004 г. ICGEB NCBI Molecular Biology Resources A Field Guide part 1

2 NCBI FieldGuide О NCBI Система NCBI Entrez Базы данных последовательностей NCBI Геномные ресурсы NCBI ** Промежуток ** Предварительно вычисленные ресурсы NCBI — за кулисами Ресурсы NCBI

3 NCBI FieldGuide Национальный институт здравоохранения Бетесда, доктор медицины

4 NCBI FieldGuide Национальный центр биотехнологической информации, созданный как часть NLM в 1988 г. — Создание общедоступных баз данных — Проведение исследований в области вычислительной биологии — Разработка программных инструментов для анализа последовательностей — Распространение биомедицинской информации

5 NCBI FieldGuide Количество пользователей и посещений в день 1997 1998 1999 2000 2001 2002 2003 Рождественские и новогодние дни В настоящее время в среднем от 10 000 000 до 35 000 000 посещений в день!

6 NCBI FieldGuide Страны происхождения

7 Веб-доступ NCBI FieldGuide: http: // www.ncbi.nlm.nih.gov

8 NCBI FieldGuide http://www.ncbi.nlm.nih.gov/About/index.html

9 NCBI FieldGuide




13 Часть 1 книжной полки NCBI.Базы данных. Часть 3. Запросы и связывание данных. Часть 2. Поток и обработка данных. Часть 4. Поддержка пользователей.

14 NCBI FieldGuide



17 OMIM — Каталог генов, участвующих в процессах заболеваний человека — Подробная клиническая и справочная информация — Курируется и поддерживается Джоном Хопкинсом — Ссылки на PubMed и базы данных последовательностей

18 NCBI FieldGuide Система Entrez Нуклеотид Entrez PubMed Таксономия белков Структура доменов 3D-домены Журнал PMC OMIM Книги PopSet SNP UniGene UniST S Геном Геном GEO GEO Наборы данных MeSH CancerChromosomes Homologen e

19 Таксономия NCBI FieldGuide

20 Данио NCBI FieldGuide

21 год

22 NCBI FieldGuide Глобальная поисковая система Entrez

23 NCBI FieldGuide


25 Типы баз данных Первичные базы данных –Оригинальные материалы, представленные экспериментаторами –Персонал базы данных просматривает и может систематизировать данные, но мы не добавляем / не изменяем дополнительную информацию –Записи «принадлежат» и обновляются их авторами. Примеры: GenBank, SNP, производные базы данных GEO. –Курируется человеком (компиляция и исправление данных)  Примеры: Ген (LocusLink), базы данных структуры и литературы –Предполагается вычислением  Пример: UniGene –Комбинация  Примеры: RefSeq, сборка генома, базы данных домена


27 NCBI FieldGuide Как запросить конкретную базу данных (term1 [разделитель тегов] op term2 [разделитель тегов] op…) тег delimiter = Entrez поле индексации op = AND, OR, НЕ Organism Journal Пользовательские соединения Автор  Логические операторы ДОЛЖНЫ быть ЗАГЛАВНЫМИ! Примеры разделителей тегов term1 term2

28 год Пример запроса NCBI FieldGuide Киназа c-src Brauninger Организм Журнал Пользовательские соединения Автор

29 NCBI FieldGuide Использование полей для поиска записей Доступ Все поля Автор Номер EC / RN Функциональный ключ Фильтр Имя гена Проблема Журнал Ключевое слово Дата изменения Организм Номер страницы Первичные свойства доступа Имя белка Дата публикации SeqID Строка Длина последовательности Имя вещества Текст Название слова Объем Наиболее полезное поле поиска [ Организм]: –человек [orgn]… или… бактерии [orgn] Полезные условия поиска в поле [Свойства]: –srcdb: «исходная база данных» (srcdb genbank [prop]) –gbdiv: «подразделение генбанка» (gbdiv est [prop ]) –Biomol: «биомолекулярный тип» (biomol mrna [prop])

30 NCBI FieldGuide # 1: тироидная пероксидаза 335 # 2: тироидная пероксидаза И человеческий [orgn] 291 # 3: тироидный пероксидаза [название] И человеческий [orgn] 166 # 4: # 3 И srcdb refseq [prop] 5 # 5: # 3 И srcdb ddbj / embl / genbank [prop] 161 # 6: # 5 И gbdiv est [prop] 20 # 7: # 5 И gbdiv pri [prop] 141 # 8: # 7 И biomol genomic [prop] 25 # 9: # 7 AND biomol mrna [prop] 116 Использование ограничений поля

31 год NCBI FieldGuide Комплексный поиск, который можно выполнять с помощью предварительного просмотра / индекса. Сколько кластеров Unigene крысы содержат хотя бы одну мРНК? крыса [организм] Термины, используемые (и проиндексированные) в полях Entrez, можно искать для получения полезной информации! 1) Выберите базу данных UniGene.2) Найдите все записи о крысах. 3) Найдите те, у которых ≥ 1 мРНК. («Не 0») НЕ

32 Комплексные запросы NCBI FieldGuide с предварительным просмотром / индексом НЕ 0 [количество мРНК]

33 NCBI FieldGuide 1º База данных последовательностей GenBank База данных только нуклеотидных последовательностей Архивирование в природе Отправка данных GenBank в NCBI — Прямая отправка отдельных записей через Интернет (BankIt, Sequin) — Пакетная отправка групповых последовательностей по электронной почте (EST, GSS, STS) — FTP-аккаунты для центров секвенирования

34 NCBI FieldGuide Записи последовательностей (миллионы) Общее количество пар оснований (миллиарды) GenBank 0 5 10 15 20 25 30 35 0 5 10 15 20 25 30 35 40 Записи последовательностей Общее количество пар оснований Версия 143: 37.3 миллиона записей 41,8 миллиарда нуклеотидов Среднее время удвоения ≈ 14 месяцев ’83 ’84 ’85 ’86 ’87 ’88 ’89 ’90 ’91 ’92 ’93 ’94 ’95 ’96 ’97 ’98 ’99 ’00 ’01 ’02 ’03 ’04

35 год Полный выпуск NCBI FieldGuide каждые два месяца, инкрементальные и кумулятивные обновления ежедневно доступны только через Интернет ftp://ftp.ncbi.nih.gov/genbank/ GenBank Release 143August 2004 37 343 937 записей 41 808 045 653 нуклеотидов> 170 000 видов 160 гигабайт 657 файлов

36 NCBI FieldGuide EBI GenBank DDBJ EMBL EMBL Entrez SRS getentry NIG CIB NCBI NIH Представления Обновления Представления Обновления Представления Обновления Международная база данных последовательностей Сотрудничество Sequin BankIt ftp

37 NCBI FieldGuide EST (335) Метка экспрессированной последовательности GSS (116) Геномный обзор Последовательность HTG (61) Геномная STS с высокой пропускной способностью (5) Сайт с меткой последовательностей HTC (6) Высокопроизводительная кДНК PRI (28) PRI приматов (12) BCT растений и грибов (10) Бактериальный и архейный INV (6) ROD беспозвоночных (13) VRL грызунов (3) Вирусный VRT (7) MAM других позвоночных (1) Млекопитающие (напр.ROD и PRI) PHG (1) Phage SYN (1) Синтетический (векторы клонирования) UNA (1) Неаннотированная организация GenBank: Разделы GenBank (gbdiv) Записи разделены на 17 разделов. — 1 патент (11 файлов) — 5 с высокой пропускной способностью — 11 традиционных традиционных разделов: прямая подача (Sequin и BankIt). Точно Хорошо охарактеризованные ОБЪЕМНЫЕ ПОДРАЗДЕЛЕНИЯ: Пакетная отправка (электронная почта и FTP) Неточно Плохо охарактеризовано

38 Форматы файлов NCBI FieldGuide для баз данных последовательностей Каждая последовательность представлена ​​текстовой записью, называемой плоским файлом.GenBank / GenPept (полезно для ученых) FASTA (простейший формат) ASN.1 и XML (полезно для программистов)

39 NCBI FieldGuide LOCUS AF062069 мРНК 3808 п.н. INV 02-MAR-2000 ОПРЕДЕЛЕНИЕ мРНК миозина III Limulus polyphemus, полные CD. ДОСТУП AF062069 ВЕРСИЯ AF062069.2 GI: 7144484 КЛЮЧЕВЫЕ СЛОВА. ИСТОЧНИК Атлантический подковообразный краб. ОРГАНИЗМ Limulus polyphemus Eukaryota; Metazoa; Членистоногие; Хелицерата; Merostomata; Ксифосура; Limulidae; Лимулус.ССЫЛКА 1 (основания с 1 по 3808) АВТОРЫ Battelle, B.-A., Andrews, A.W., Calman, B.G., Sellers, J.R., Greenberg, R.M. и Смит, W.C. НАЗВАНИЕ Миозин III из глаз Limulus — это регулируемый часами фосфопротеин JOURNAL J. Neurosci. (1998) В прессе ССЫЛКА 2 (основания с 1 по 3808) АВТОРЫ Battelle, B.-A., Andrews, A.W., Calman, B.G., Sellers, J.R., Greenberg, R.M. и Смит, W.C. НАЗВАНИЕ Прямая подача ЖУРНАЛ Представлен (29 апреля 1998 г.) Лаборатория Уитни, Университет Флориды, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, США ССЫЛКА 3 (базы с 1 по 3808) АВТОРЫ Battelle, B.-А., Эндрюс, А.В., Калман, Б.Г., Селлерс, Дж. Р., Гринберг, Р.М. и Смит, W.C. НАЗВАНИЕ Прямая подача ЖУРНАЛ Представлен (2 марта 2000 г.) Лаборатория Уитни, Университет Флориды, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, США ПРИМЕЧАНИЕ Обновление последовательности, предоставленное подателем КОММЕНТАРИЙ 2 марта 2000 г. эта версия последовательности заменила gi: 3132700. Ссылки ОПРЕДЕЛЕНИЕ мРНК миозина III Limulus polyphemus, полные CD.LOCUS AF0620069 МРНК 3808 п.н. INV 02-MAR-2000 ОРГАНИЗМ Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus.Традиционное определение записи «GenBank» = Заголовок ДОСТУП AF062069 ВЕРСИЯ AF062069.2 GI: 7144484 Номер доступа NCBI в таксономии. Версия Номер GI Номер доступа Длина мРНК = ДНК кДНК = Дата деления генома последней модификации

40 NCBI FieldGuide ХАРАКТЕРИСТИКИ Местоположение / Квалификаторы источник 1..3808 / organ = «Limulus polyphemus» / db_xref = «taxon: 6850» / fabric_type = «lateral eye» CDS 258..3302 / note = «N-концевой домен протеинкиназы; C -концевая головка тяжелой цепи миозина; субстрат для PKA «/ codon_start = 1 / product =» myosin III «/ protein_id =» AAC16332.2″ / db_xref = «GI: 7144485» / перевод = «MEYKCISEHLPFETLPDPGDRFEVQELVGTGTYATVYSAIDKQA NKKVALKIIGHIAENLLDIETEYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWLGI EFLEEGTAADLLATHRRFGIHLKEDLIALIIKEVVRAVQYLHENSIIHRDIRAANIMF SKEGYVKLIDFGLSASVKNTNGKAQSSVGSPYWMAPEVISCDCLQEPYNYTCDVWSIG ITAIELADTVPSLSDIHALRAMFRINRNPPPSVKRETRWSETLKDFISECLVKNPEYR PCIQEIPQHPFLAQVEGKEDQLRSELVDILKKNPGEKLRNKPYNVTFKNGHLKTISGQ БАЗА СЧЕТ 201 689 с 782 г 1136 т ПРОИСХОЖДЕНИЕ 1 tcgacatctg tggtcgcttt ttttagtaat aaaaaattgt attatgacgt cctatctgtt 3781 aagatacagt aactagggaa AAAAAAAA // Нижнего вниз в GenBank записи / protein_id = «AAC16332.2 «/ db_xref =» GI: 7144485 «Таблица функций идентификатора белка GenPept


42 NCBI FieldGuide Seq-entry :: = set {level 1, class nuc-prot, descr {title «МРНК пероксидазы щитовидной железы человека, частичные компакт-диски и переведенные продукты», источник {org {taxname «Homo sapiens», обычное слово «человек») , db {{db «taxon», tag id 9606}}, orgname {name binomial {род «Homo», разновидность «sapiens»}, линия «Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates ; Catarrhini; Hominidae; Homo «, Нотация абстрактного синтаксиса: ASN.1 нуклеотид FASTA, протеин FASTA GenPeptGenBank ASN.1

43 год NCBI FieldGuide Bulk Divisions Метка экспрессированной последовательности –1-й проход однократного считывания кДНК Геномный обзор Последовательность –1-й проход однократного считывания гДНК Высокая производительность Геном – неполные последовательности геномных клонов Сайт с меткой последовательности –реагенты для картирования на основе ПЦР Пакетная отправка и htg (электронная почта и ftp ) Неточно Плохо охарактеризовано


45 NCBI FieldGuide Секвенирование генома — HTG, GSS, (WGS) Предварительная последовательность (HTG-разделение) измельчение Целая вставка BAC (или генома) клонирование изолирующая сборка секвенирование Секвенирование GSS-разделение или архив трассировки полные сборки генома дробовика (традиционное разделение)

46 Подразделение NCBI FieldGuide HTG: Черновые последовательности Honeybee Незаконченные последовательности BAC Пробелы и неупорядоченные фрагменты Готовые последовательности перемещаются в традиционное подразделение GenBank

47 NCBI FieldGuide Другие первичные базы данных GEOGEO (Омнибус экспрессии генов) — Репозиторий данных на микрочипах с возможностью поиска SNPSNP (Полиморфизм одиночных нуклеотидов) — Аллельные вариации (включая минисателлиты / простые повторы и вставки / делеции последовательностей)

48 NCBI FieldGuide Отправка и обновление данных Запрос базы данных: идентификаторы генов информационная последовательность полей Просмотр наборов данных Загрузка данных Новый дизайн с новыми функциями

49 NCBI FieldGuide Описание платформы GPL Интенсивность необработанных / обработанных пятен GSM из одного слайда / чипа GSE Группировка данных слайда / чипа «один эксперимент» GDS Группировка экспериментов Куратор NCBI Представлено экспериментаторами Представлено производителем * Entrez GEO Entrez GEO Datasets

50 NCBI FieldGuide src1: CMV-инфицированные фибробласты src2: неинфицированные фибробласты GSM827: FHCMV-T-1 GSM825: FHCMV-T-2 GSM828: FHCMV-T-3 GSM829: FHCMV-H-1 GSM830: FHCMV31-H-2 H-3 GSM832: CMV_AD169-2 GSM833: CMV_AD169-3 GDS177: ЦМВ-инфекция клеток HFF Сравнение профилей экспрессии генов клеток HFF, инфицированных штаммами CMV FHCRC некоммерческая экспрессия массива 18K человека

51 NCBI FieldGuide PRNP






57 год SNP — GeneView
